SEC11C Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-80774

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Validated:

Human

Cited:

Human

Applications

Validated:

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Cited:

Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all SEC11C Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: MVRAGAVGAHLPASGLDIFGDLKKMNKRQLYYQV

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (88%), Rat (88%)

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for SEC11C Antibody - BSA Free

Western Blot: SEC11C Antibody [NBP1-80774]

Western Blot: SEC11C Antibody [NBP1-80774]

Western Blot: SEC11C Antibody [NBP1-80774] - Analysis in control (vector only transfected HEK293T lysate) and SEC11C over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunohistochemistry-Paraffin: SEC11C Antibody [NBP1-80774]

Immunohistochemistry-Paraffin: SEC11C Antibody [NBP1-80774]

Immunohistochemistry-Paraffin: SEC11C Antibody [NBP1-80774] - Staining of human Pancreas shows strong positivity in endoplasmic reticulum in exocrine glandular cells.
Western Blot: SEC11C Antibody [NBP1-80774]

Western Blot: SEC11C Antibody [NBP1-80774]

Western Blot: SEC11C Antibody [NBP1-80774] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane 5: Human liver tissue. Lane 6: Human tonsil tissue
Immunohistochemistry-Paraffin: SEC11C Antibody [NBP1-80774]

Immunohistochemistry-Paraffin: SEC11C Antibody [NBP1-80774]

Immunohistochemistry-Paraffin: SEC11C Antibody [NBP1-80774] - Staining of human lymph node shows strong cytoplasmic positivity in subsets of lymphoid cells outside reaction centra.
Immunohistochemistry-Paraffin: SEC11C Antibody [NBP1-80774]

Immunohistochemistry-Paraffin: SEC11C Antibody [NBP1-80774]

Immunohistochemistry-Paraffin: SEC11C Antibody [NBP1-80774] - Staining of human Kidney shows moderate positivity in endoplasmic reticulum in cells in tubules.
Immunohistochemistry-Paraffin: SEC11C Antibody [NBP1-80774]

Immunohistochemistry-Paraffin: SEC11C Antibody [NBP1-80774]

Immunohistochemistry-Paraffin: SEC11C Antibody [NBP1-80774] - Staining of human Skeletal muscle shows very weak positivity in endoplasmic reticulum in myocytes.

Applications for SEC11C Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50-1:200

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: SEC11C

SEC11C is a component of the microsomal signal peptidase complex which removes signal peptides from nascent proteins asthey are translocated into the lumen of the endoplasmic reticulum

Alternate Names

EC 3.4, Microsomal signal peptidase 21 kDa subunit, SEC11 homolog C, SEC11 homolog C (S. cerevisiae), SEC11L3, SEC11-like protein 3, signal peptidase complex catalytic subunit SEC11C, SPase 21 kDa subunit, SPC21SEC11-like 3 (S. cerevisiae), SPCS4CSEC11-like 3

Entrez Gene IDs

90701 (Human)

Gene Symbol

SEC11C

Additional SEC11C Products

Product Documents for SEC11C Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for SEC11C Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for SEC11C Antibody - BSA Free

Customer Reviews for SEC11C Antibody - BSA Free

There are currently no reviews for this product. Be the first to review SEC11C Antibody - BSA Free and earn rewards!

Have you used SEC11C Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies