SEC14L2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-35155

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all SEC14L2 Primary Antibodies »

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 60-270 of human SEC14L2 (NP_001191133.1).

Sequence:
GRKVETITIIYDCEGLGLKHLWKPAVEAYGEFLCMFEENYPETLKRLFVVKAPKLFPVAYNLIKPFLSEDTRKKIMVLGANWKEVLLKHISPDQVPVEYGGTMTDPDGNPKCKSKINYGGDIPRKYYVRDQVKQQYEHSVQISRGSSHQVEYEILFPGCVLRWQFMSDGADVGFGIFLKTKMGERQRAGEMTEVLPNQRYNSHLVPEDGTL

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

46 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for SEC14L2 Antibody - BSA Free

SEC14L2 Antibody

Immunohistochemistry: SEC14L2 Antibody [NBP3-35155] -

Immunohistochemistry: SEC14L2 Antibody [NBP3-35155] - Immunohistochemistry analysis of paraffin-embedded Human esophageal cancer using SEC14L2 Rabbit pAb at dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.
SEC14L2 Antibody

Immunohistochemistry: SEC14L2 Antibody [NBP3-35155] -

Immunohistochemistry: SEC14L2 Antibody [NBP3-35155] - Immunohistochemistry analysis of paraffin-embedded Mouse pancreas using SEC14L2 Rabbit pAb at dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.
SEC14L2 Antibody

Immunohistochemistry: SEC14L2 Antibody [NBP3-35155] -

Immunohistochemistry: SEC14L2 Antibody [NBP3-35155] - Immunohistochemistry analysis of paraffin-embedded Rat lung using SEC14L2 Rabbit pAb at dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.
SEC14L2 Antibody

Immunocytochemistry/ Immunofluorescence: SEC14L2 Antibody [NBP3-35155] -

Immunocytochemistry/ Immunofluorescence: SEC14L2 Antibody [NBP3-35155] - Immunofluorescence analysis of U-2 OS cells using SEC14L2 Rabbit pAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
SEC14L2 Antibody

Western Blot: SEC14L2 Antibody [NBP3-35155] -

Western Blot: SEC14L2 Antibody [NBP3-35155] - Western blot analysis of various lysates using SEC14L2 Rabbit pAb at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 10s.

Applications for SEC14L2 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:100

Immunohistochemistry-Paraffin

1:50 - 1:200

Western Blot

1:1000 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: SEC14L2

SEC14L2 encodes a cytosolic protein which belongs to a family of lipid-binding proteins including Sec14p, alpha-tocopherol transfer protein, and cellular retinol-binding protein. The encoded protein stimulates squalene monooxygenase which is a downstream enzyme in the cholesterol biosynthetic pathway.

Alternate Names

C22orf6, hTAP, KIAA1186SEC14 (S. cerevisiae)-like 2, KIAA1658SPFAlpha-tocopherol-associated protein, SEC14-like 2 (S. cerevisiae), SEC14-like protein 2, Squalene transfer protein, Supernatant protein factor, TAP1, TAPMGC65053, tocopherol-associated protein

Gene Symbol

SEC14L2

Additional SEC14L2 Products

Product Documents for SEC14L2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for SEC14L2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for SEC14L2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review SEC14L2 Antibody - BSA Free and earn rewards!

Have you used SEC14L2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies