SEC23B Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-35503

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all SEC23B Primary Antibodies »

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 150-250 of human SEC23B (NP_006354.2).

Sequence:
SLQMSLSLLPPDALVGLITFGRMVQVHELSCEGISKSYVFRGTKDLTAKQIQDMLGLTKPAMPMQQARPAQPQEHPFASSRFLQPVHKIDMNLTDLLGELQ

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

86 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for SEC23B Antibody - BSA Free

SEC23B Antibody

Immunocytochemistry/ Immunofluorescence: SEC23B Antibody [NBP3-35503] -

Immunocytochemistry/ Immunofluorescence: SEC23B Antibody [NBP3-35503] - Immunofluorescence analysis of L929 cells using SEC23B Rabbit pAb at dilution of 1:100. Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
SEC23B Antibody

Immunocytochemistry/ Immunofluorescence: SEC23B Antibody [NBP3-35503] -

Immunocytochemistry/ Immunofluorescence: SEC23B Antibody [NBP3-35503] - Immunofluorescence analysis of U-2 OS cells using SEC23B Rabbit pAb at dilution of 1:100. Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
SEC23B Antibody

Immunocytochemistry/ Immunofluorescence: SEC23B Antibody [NBP3-35503] -

Immunocytochemistry/ Immunofluorescence: SEC23B Antibody [NBP3-35503] - Immunofluorescence analysis of C6 cells using SEC23B Rabbit pAb at dilution of 1:100. Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
SEC23B Antibody

Western Blot: SEC23B Antibody [NBP3-35503] -

Western Blot: SEC23B Antibody [NBP3-35503] - Western blot analysis of various lysates using SEC23B Rabbit pAb at 1:500 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 30s.

Applications for SEC23B Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Western Blot

1:500 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.01% Thimerosal

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: SEC23B

SEC23B is a component of the COPII coat that covers ER derived vesicles involved in transport from the endoplasmic reticulum to the Golgi apparatus. COPII acts in the cytoplasm to promote the transport of secretory, plasma membrane, and vacuolar proteins from the endoplasmic reticulum to the Golgi complex.

Alternate Names

CDAII, CDA-II, CDAN2, congenital dyserythropoietic anemia, type II, HEMPASSec23 (S. cerevisiae) homolog B, protein transport protein Sec23B, Sec23 homolog B (S. cerevisiae), SEC23-like protein B, SEC23-related protein B, transport protein SEC23B

Gene Symbol

SEC23B

Additional SEC23B Products

Product Documents for SEC23B Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for SEC23B Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for SEC23B Antibody - BSA Free

There are currently no reviews for this product. Be the first to review SEC23B Antibody - BSA Free and earn rewards!

Have you used SEC23B Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies