SEC23IP Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-35544

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all SEC23IP Primary Antibodies »

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 600-940 of human SEC23IP (NP_009121.1).

Sequence:
NLSKCPGPLAVANGVVKQLHFQEKQMPEEPKLTLDESYDLVVENKEVLTLQETLEALSLSEYFSTFEKEKIDMESLLMCTVDDLKEMGIPLGPRKKIANFVEHKAAKLKKAASEKKAVAATSTKGQEQSAQKTKDMASLPSESNEPKRKLPVGACVSSVCVNYESFEVGAGQVSVAYNSLDFEPEIFFALGSPIAMFLTIRGVDRIDENYSLPTCKGFFNIYHPLDPVAYRLEPMIVPDLDLKAVLIPHHKGRKRLHLELKESLSRMGSDLKQGFISSLKSAWQTLNEFARAHTSSTQLQEELEKVANQIKEEEEKQVVEAEKVVESPDFSKDEDYLGKVG

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

111 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for SEC23IP Antibody - BSA Free

SEC23IP Antibody

Immunocytochemistry/ Immunofluorescence: SEC23IP Antibody [NBP3-35544] -

Immunocytochemistry/ Immunofluorescence: SEC23IP Antibody [NBP3-35544] - Immunofluorescence analysis of HeLa cells using SEC23IP Rabbit pAb at dilution of 1:100. Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
SEC23IP Antibody

Western Blot: SEC23IP Antibody [NBP3-35544] -

Western Blot: SEC23IP Antibody [NBP3-35544] - Western blot analysis of various lysates using SEC23IP Rabbit pAb at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 3s.
SEC23IP Antibody

Immunohistochemistry: SEC23IP Antibody [NBP3-35544] -

Immunohistochemistry: SEC23IP Antibody [NBP3-35544] - Immunohistochemistry analysis of paraffin-embedded Human liver cancer using SEC23IP Rabbit pAb at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.
SEC23IP Antibody

Immunocytochemistry/ Immunofluorescence: SEC23IP Antibody [NBP3-35544] -

Immunocytochemistry/ Immunofluorescence: SEC23IP Antibody [NBP3-35544] - Immunofluorescence analysis of L929 cells using SEC23IP Rabbit pAb at dilution of 1:100. Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
SEC23IP Antibody

Immunocytochemistry/ Immunofluorescence: SEC23IP Antibody [NBP3-35544] -

Immunocytochemistry/ Immunofluorescence: SEC23IP Antibody [NBP3-35544] - Immunofluorescence analysis of C6 cells using SEC23IP Rabbit pAb at dilution of 1:100. Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

Applications for SEC23IP Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200

Western Blot

1:200 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.01% Thimerosal

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: SEC23IP

COPII-coated vesicles are involved in protein transport from the endoplasmic reticulum to the Golgi apparatus. The protein encoded by this gene was identified by its interaction with a mouse protein similar to yeast Sec23p, an essential component of the COPII. This protein shares significant similarity with phospholipid-modifying proteins, especially phosphatidic acid preferring-phospholipase A1. Overexpression of this protein has been shown to cause disorganization of the endoplasmic reticulum-Golgi intermediate compartment and Golgi apparatus, which suggests its role in the early secretory pathway.

Alternate Names

p125, P125A, SEC23 interacting protein, SEC23-interacting protein

Gene Symbol

SEC23IP

Additional SEC23IP Products

Product Documents for SEC23IP Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for SEC23IP Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for SEC23IP Antibody - BSA Free

There are currently no reviews for this product. Be the first to review SEC23IP Antibody - BSA Free and earn rewards!

Have you used SEC23IP Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies