SECISBP2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-38323

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all SECISBP2 Primary Antibodies »

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 585-854 of human SECISBP2 (NP_076982.3).

Sequence:
DELISTPSVEDKSEEPPGTELQRDTEASHLAPNHTTFPKIHSRRFRDYCSQMLSKEVDACVTDLLKELVRFQDRMYQKDPVKAKTKRRLVLGLREVLKHLKLKKLKCVIISPNCEKIQSKGGLDDTLHTIIDYACEQNIPFVFALNRKALGRSLNKAVPVSVVGIFSYDGAQDQFHKMVELTVAARQAYKTMLENVQQELVGEPRPQAPPSLPTQGPSCPAEDGPPALKEKEEPHYIEIWKKHLEAYSGCTLELEESLEASTSQMMNLNL

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

95 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for SECISBP2 Antibody - BSA Free

SECISBP2 Antibody

Immunohistochemistry: SECISBP2 Antibody [NBP3-38323] -

Immunohistochemistry: SECISBP2 Antibody [NBP3-38323] - Immunohistochemistry analysis of paraffin-embedded Human colon carcinoma using SECISBP2 Rabbit pAb at dilution of 1:200 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.
SECISBP2 Antibody

Immunocytochemistry/ Immunofluorescence: SECISBP2 Antibody [NBP3-38323] -

Immunocytochemistry/ Immunofluorescence: SECISBP2 Antibody [NBP3-38323] - Immunofluorescence analysis of U2OS cells using SECISBP2 Rabbit pAb at dilution of 1:50 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
SECISBP2 Antibody

Immunocytochemistry/ Immunofluorescence: SECISBP2 Antibody [NBP3-38323] -

Immunocytochemistry/ Immunofluorescence: SECISBP2 Antibody [NBP3-38323] - Immunofluorescence analysis of NIH/3T3 cells using SECISBP2 Rabbit pAb at dilution of 1:50 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
SECISBP2 Antibody

Immunocytochemistry/ Immunofluorescence: SECISBP2 Antibody [NBP3-38323] -

Immunocytochemistry/ Immunofluorescence: SECISBP2 Antibody [NBP3-38323] - Immunofluorescence analysis of HeLa cells using SECISBP2 Rabbit pAb at dilution of 1:50 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
SECISBP2 Antibody

Western Blot: SECISBP2 Antibody [NBP3-38323] -

Western Blot: SECISBP2 Antibody [NBP3-38323] - Western blot analysis of various lysates using SECISBP2 Rabbit pAb at 1:500 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 180s.
SECISBP2 Antibody

Immunohistochemistry: SECISBP2 Antibody [NBP3-38323] -

Immunohistochemistry: SECISBP2 Antibody [NBP3-38323] - Immunohistochemistry analysis of paraffin-embedded Human liver damage using SECISBP2 Rabbit pAb at dilution of 1:200 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.

Applications for SECISBP2 Antibody - BSA Free

Application
Recommended Usage

ELISA

Recommended starting concentration is 1 μg/mL.

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200

Western Blot

1:100 - 1:500

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: SECISBP2

SECISBP2 is an RNA binding protein that interacts with the Sec insertion sequence (SECIS) element in selenoprotein mRNAs. The incorporation of selenocysteine into a protein requires the concerted action of an mRNA element called a sec insertion sequence (SECIS), a selenocysteine-specific translation elongation factor and a SECIS binding protein. With these elements in place, a UGA codon can be decoded as selenocysteine. Mutations in the SECISBP2 gene have been associated with a reduction in activity of a specific thyroxine deiodinase, a selenocysteine-containing enzyme, and abnormal thyroid hormone metabolism.

Alternate Names

DKFZp686C09169, SBP2SECIS-binding protein 2, SECIS binding protein 2, selenocysteine insertion sequence binding protein 2, selenocysteine insertion sequence-binding protein 2

Gene Symbol

SECISBP2

Additional SECISBP2 Products

Product Documents for SECISBP2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for SECISBP2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for SECISBP2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review SECISBP2 Antibody - BSA Free and earn rewards!

Have you used SECISBP2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies