Secretory phospholipase A2 Type V Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-88236

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all Secretory phospholipase A2 Type V Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human Secretory phospholipase A2 Type V. Peptide sequence: MKGLLPLAWFLACSVPAVQGGLLDLKSMIEKVTGKNALTNYGFYGCYCGW The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for Secretory phospholipase A2 Type V Antibody - BSA Free

Western Blot: Secretory phospholipase A2 Type V Antibody [NBP2-88236]

Western Blot: Secretory phospholipase A2 Type V Antibody [NBP2-88236]

Western Blot: Secretory phospholipase A2 Type V Antibody [NBP2-88236] - WB Suggested Anti-PLA2G5 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:312500. Positive Control: Human Thymus
Immunohistochemistry-Paraffin: Secretory phospholipase A2 Type V Antibody [NBP2-88236]

Immunohistochemistry-Paraffin: Secretory phospholipase A2 Type V Antibody [NBP2-88236]

Immunohistochemistry-Paraffin: Secretory phospholipase A2 Type V Antibody [NBP2-88236] - Rabbit Anti-PLA2G5 antibody. Formalin Fixed Paraffin Embedded Tissue: Human Heart. Primary antibody Concentration: 10 ug/ml

Applications for Secretory phospholipase A2 Type V Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Secretory phospholipase A2 Type V

The Secretory phospholipase A2 Type V gene is a member of the secretory phospholipase A2 family. It is located in a tightly-linked cluster of secretory phospholipase A2 genes on chromosome 1. The encoded enzyme catalyzes the hydrolysis of membrane phospholipids to generate lysophospholip

Alternate Names

Ca2+-dependent phospholipase A2, calcium-dependent phospholipase A2, DKFZp686C2294, EC 3.1.1.4, Group V phospholipase A2, GV-PLA2, hVPLA(2), MGC46205, Phosphatidylcholine 2-acylhydrolase 5, phospholipase A2, group V, PLA2-10

Gene Symbol

PLA2G5

Additional Secretory phospholipase A2 Type V Products

Product Documents for Secretory phospholipase A2 Type V Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Secretory phospholipase A2 Type V Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Secretory phospholipase A2 Type V Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Secretory phospholipase A2 Type V Antibody - BSA Free and earn rewards!

Have you used Secretory phospholipase A2 Type V Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies