Septin-5 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-49407

Novus Biologicals
Loading...

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Validated:

Human

Predicted:

Mouse (97%), Rat (97%). Backed by our 100% Guarantee.

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: VPLIAKADCLVPSEIRKLKERIREEIDKFGIHVYQFPE

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Septin-5 Antibody - BSA Free

Immunohistochemistry-Paraffin: Septin-5 Antibody [NBP2-49407]

Immunohistochemistry-Paraffin: Septin-5 Antibody [NBP2-49407]

Immunohistochemistry-Paraffin: Septin-5 Antibody [NBP2-49407] - Staining of human liver shows low expression as expected.
Immunohistochemistry-Paraffin: Septin-5 Antibody [NBP2-49407]

Immunohistochemistry-Paraffin: Septin-5 Antibody [NBP2-49407]

Immunohistochemistry-Paraffin: Septin-5 Antibody [NBP2-49407] - Staining of human cerebral cortex shows high expression.
Immunohistochemistry-Paraffin: Septin-5 Antibody [NBP2-49407]

Immunohistochemistry-Paraffin: Septin-5 Antibody [NBP2-49407]

Immunohistochemistry-Paraffin: Septin-5 Antibody [NBP2-49407] - Staining in human cerebral cortex and liver tissues using anti-SEPT5 antibody. Corresponding SEPT5 RNA-seq data are presented for the same tissues.

Applications for Septin-5 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:20 - 1:50

Immunohistochemistry-Paraffin

1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Septin-5

This gene is a member of the septin gene family of nucleotide binding proteins, originally described in yeast as cell division cycle regulatory proteins. Septins are highly conserved in yeast, Drosophila, and mouse and appear to regulate cytoskeletal organization. Disruption of septin function disturbs cytokinesis and results in large multinucleate or polyploid cells. This gene is mapped to 22q11, the region frequently deleted in DiGeorge and velocardiofacial syndromes. A translocation involving the MLL gene and this gene has also been reported in patients with acute myeloid leukemia. Two transcripts of this gene, a major one of 2.2 kb and a minor one of 3.5 kb, have been observed. The 2.2 kb form results from the utilization of a non-consensus polyA signal (AACAAT). In the absence of polyadenylation from this imperfect site, the consensus polyA signal of the downstream neighboring gene (GP1BB; platelet glycoprotein Ib) is used, resulting in the 3.5 kb transcript. An alternatively spliced transcript variant with a different 5' end has also been identified, but its full-length nature has not been completely determined. [provided by RefSeq]

Alternate Names

CDCREL, CDCREL1, CDCrel-1, cell division control related protein 1, Cell division control-related protein 1, HCDCREL-1, peanut-like 1, peanut-like 1 (Drosophila), Peanut-like protein 1, platelet glycoprotein Ib beta chain, PNUTL1H5, septin 5, septin-5

Gene Symbol

SEPTIN5

Additional Septin-5 Products

Product Documents for Septin-5 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Septin-5 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Septin-5 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Septin-5 Antibody - BSA Free and earn rewards!

Have you used Septin-5 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...