Serine Dehydratase Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-87070

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all Serine Dehydratase Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: PATIVVPSTTPALTIERLKNEGATVKVVGELLDEAFELAKALAKNNPGWVYIPPFDDPLIWEGHASIVKELKE

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (86%), Rat (89%)

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Serine Dehydratase Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: Serine Dehydratase Antibody [NBP1-87070]

Immunocytochemistry/ Immunofluorescence: Serine Dehydratase Antibody [NBP1-87070]

Immunocytochemistry/Immunofluorescence: Serine Dehydratase Antibody [NBP1-87070] - Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol & mitochondria.
Serine Dehydratase Antibody Immunohistochemistry-Paraffin: Serine Dehydratase Antibody [NBP1-87070] -

Immunohistochemistry-Paraffin: Serine Dehydratase Antibody [NBP1-87070] -

Staining of human kidney shows moderate cytoplasmic-granular positivity in cells in tubules.
Serine Dehydratase Antibody Immunohistochemistry-Paraffin: Serine Dehydratase Antibody [NBP1-87070] -

Immunohistochemistry-Paraffin: Serine Dehydratase Antibody [NBP1-87070] -

Staining of human placenta shows moderate cytoplasmic positivity in trophoblastic cells.
Serine Dehydratase Antibody Immunohistochemistry-Paraffin: Serine Dehydratase Antibody [NBP1-87070] -

Immunohistochemistry-Paraffin: Serine Dehydratase Antibody [NBP1-87070] -

Staining of human liver shows moderate cytoplasmic positivity in hepatocytes.
Serine Dehydratase Antibody Immunohistochemistry-Paraffin: Serine Dehydratase Antibody [NBP1-87070] -

Immunohistochemistry-Paraffin: Serine Dehydratase Antibody [NBP1-87070] -

Staining of human stomach shows strong cytoplasmic-membranous positivity in glandular cells.

Applications for Serine Dehydratase Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Paraffin

1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Serine Dehydratase

Serine Dehydratase encodes one of three enzymes that are involved in metabolizing serine and glycine. L-serine dehydratase converts L-serine to pyruvate and ammonia and requires pyridoxal phosphate as a cofactor. The encoded protein can also metabolize threonine to NH4+ and 2-ketobutyrate. The encoded protein is found predominantly in the liver. [provided by RefSeq]

Alternate Names

EC 4.3.1.17, EC 4.3.1.19, L-serine ammonia-lyase, L-serine deaminase, L-serine dehydratase/L-threonine deaminase, L-threonine dehydratase, SDHL-serine dehydratase, serine dehydratase, TDH

Gene Symbol

SDS

Additional Serine Dehydratase Products

Product Documents for Serine Dehydratase Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Serine Dehydratase Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Serine Dehydratase Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Serine Dehydratase Antibody - BSA Free and earn rewards!

Have you used Serine Dehydratase Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies