SF3B14 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-87430

Novus Biologicals
100% Guarantee

Key Product Details

Validated by

Orthogonal Validation, Independent Antibodies

Species Reactivity

Validated:

Human

Predicted:

Mouse (100%), Rat (95%). Backed by our 100% Guarantee.

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all SF3B14 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: MAMQAAKRANIRLPPEVNRILYIRNLPYKITAEEMYDIFGKYGPIRQIRVGNTPETRGTAYVV

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for SF3B14 Antibody - BSA Free

Immunohistochemistry-Paraffin: SF3B14 Antibody [NBP1-87430]

Immunohistochemistry-Paraffin: SF3B14 Antibody [NBP1-87430]

Immunohistochemistry-Paraffin: SF3B14 Antibody [NBP1-87430] - Staining in human breast and skeletal muscle tissues using NBP1-87430 antibody. Corresponding SF3B6 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: SF3B14 Antibody [NBP1-87430]

Immunohistochemistry-Paraffin: SF3B14 Antibody [NBP1-87430]

Immunohistochemistry-Paraffin: SF3B14 Antibody [NBP1-87430] - Staining of human breast shows moderate nuclear positivity in glandular cells.
Immunohistochemistry-Paraffin: SF3B14 Antibody [NBP1-87430]

Immunohistochemistry-Paraffin: SF3B14 Antibody [NBP1-87430]

Immunohistochemistry-Paraffin: SF3B14 Antibody [NBP1-87430] - Staining of human breast, colon, skeletal muscle and testis using Anti-SF3B6 antibody NBP1-87430 (A) shows similar protein distribution across tissues to independent antibody NBP1-87431 (B).
Immunohistochemistry-Paraffin: SF3B14 Antibody [NBP1-87430]

Immunohistochemistry-Paraffin: SF3B14 Antibody [NBP1-87430]

Immunohistochemistry-Paraffin: SF3B14 Antibody [NBP1-87430] - Staining of human colon shows moderate nuclear positivity in glandular cells.
Immunohistochemistry-Paraffin: SF3B14 Antibody [NBP1-87430]

Immunohistochemistry-Paraffin: SF3B14 Antibody [NBP1-87430]

Immunohistochemistry-Paraffin: SF3B14 Antibody [NBP1-87430] - Staining of human skeletal muscle shows no positivity in myocytes as expected.
Immunohistochemistry-Paraffin: SF3B14 Antibody [NBP1-87430]

Immunohistochemistry-Paraffin: SF3B14 Antibody [NBP1-87430]

Immunohistochemistry-Paraffin: SF3B14 Antibody [NBP1-87430] - Staining of human testis shows strong nuclear positivity in cells in seminiferous ducts.

Applications for SF3B14 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:20 - 1:50

Immunohistochemistry-Paraffin

1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: SF3B14

The SF3B14 gene encodes a 14 kDa protein subunit of the splicing factor 3b complex. Splicing factor 3b associates with both the U2 and U11/U12 small nuclear ribonucleoprotein complexes (U2 snRNP) of spliceosomes. This 14 kDa protein interacts directly with subu

Alternate Names

HSPC175, Ht006, P14, pre-mRNA branch site protein p14, SAP14, SF3b 14 kDa subunit, SF3B14a, spliceosome-associated protein, 14 kDa subunit, splicing factor 3B, 14 kDa subunit

Gene Symbol

SF3B6

Additional SF3B14 Products

Product Documents for SF3B14 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for SF3B14 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for SF3B14 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review SF3B14 Antibody - BSA Free and earn rewards!

Have you used SF3B14 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies