SF3B4 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-57419

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Synthetic peptides corresponding to SF3B4 (splicing factor 3b, subunit 4, 49kDa) The peptide sequence was selected from the N terminal of SF3B4. Peptide sequence QDATVYVGGLDEKVSEPLLWELFLQAGPVVNTHMPKDRVTGQHQGYGFVE. The peptide sequence for this immunogen was taken from within the described region.

Specificity

This product is specific to Subunit or Isoform: 4.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for SF3B4 Antibody - BSA Free

Western Blot: SF3B4 Antibody [NBP1-57419]

Western Blot: SF3B4 Antibody [NBP1-57419]

Western Blot: SF3B4 Antibody [NBP1-57419] - HepG2 cell lysate, Antibody Titration: 1.25ug/ml
Immunohistochemistry-Paraffin: SF3B4 Antibody [NBP1-57419]

Immunohistochemistry-Paraffin: SF3B4 Antibody [NBP1-57419]

Immunohistochemistry-Paraffin: SF3B4 Antibody [NBP1-57419] - Human Intestine Tissue, antibody concentration 4-8ug/ml. Cells with positive label: Epithelial cells of intestinal villus (indicated with arrows) 400X magnification.

Applications for SF3B4 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:10-1:500

Immunohistochemistry-Paraffin

1:10-1:500

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Protein A purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

1 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: SF3B4

SF3B4 is one of four subunits of the splicing factor 3B. The protein cross-links to a region in the pre-mRNA immediately upstream of the branchpoint sequence in pre-mRNA in the prespliceosomal complex A. It also may be involved in the assembly of the B, C and E spliceosomal complexes. In addition to RNA-binding activity, this protein interacts directly and highly specifically with subunit 2 of the splicing factor 3B. This protein contains two N-terminal RNA-recognition motifs (RRMs), consistent with the observation that it binds directly to pre-mRNA.This gene encodes one of four subunits of the splicing factor 3B. The protein encoded by this gene cross-links to a region in the pre-mRNA immediately upstream of the branchpoint sequence in pre-mRNA in the prespliceosomal complex A. It also may be involved in the assembly of the B, C and E spliceosomal complexes. In addition to RNA-binding activity, this protein interacts directly and highly specifically with subunit 2 of the splicing factor 3B. This protein contains two N-terminal RNA-recognition motifs (RRMs), consistent with the observation that it binds directly to pre-mRNA.

Alternate Names

Hsh49, pre-mRNA splicing factor SF3b 49 kDa subunit, Pre-mRNA-splicing factor SF3b 49 kDa subunit, SAP 49, SAP49MGC10828, SF3B49, SF3b50, spliceosomal protein, spliceosome-associated protein (U2 snRNP), Spliceosome-associated protein 49, splicing factor 3B subunit 4, splicing factor 3b, subunit 4, 49kD, splicing factor 3b, subunit 4, 49kDa

Gene Symbol

SF3B4

UniProt

Additional SF3B4 Products

Product Documents for SF3B4 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for SF3B4 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for SF3B4 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review SF3B4 Antibody - BSA Free and earn rewards!

Have you used SF3B4 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...