SFRS7 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-88251

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
Loading...

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of human SFRS7. Peptide sequence: MSRYGRYGGETKVYVGNLGTGAGKGELERAFSYYGPLRTVWIARNPPGFA The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for SFRS7 Antibody - BSA Free

Western Blot: SFRS7 Antibody [NBP2-88251]

Western Blot: SFRS7 Antibody [NBP2-88251]

Western Blot: SFRS7 Antibody [NBP2-88251] - WB Suggested Anti-SFRS7 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:62500. Positive Control: Human Lung
Immunohistochemistry-Paraffin: SFRS7 Antibody [NBP2-88251]

Immunohistochemistry-Paraffin: SFRS7 Antibody [NBP2-88251]

Immunohistochemistry-Paraffin: SFRS7 Antibody [NBP2-88251] - Rabbit Anti-SFRS7 antibody. Formalin Fixed Paraffin Embedded Tissue: Human Placenta. Primary antibody Concentration: 1:200. Secondary Antibody: Donkey anti-Rabbit-Cy3. Secondary Antibody Concentration: 1:200. Magnification: 20x.
Western Blot: SFRS7 Antibody [NBP2-88251]

Western Blot: SFRS7 Antibody [NBP2-88251]

Western Blot: SFRS7 Antibody [NBP2-88251] - Host: Rabbit. Target Name: SRSF7. Sample Tissue: Human A549 Whole Cell. Antibody Dilution: 3ug/ml
Immunohistochemistry-Paraffin: SFRS7 Antibody [NBP2-88251]

Immunohistochemistry-Paraffin: SFRS7 Antibody [NBP2-88251]

Immunohistochemistry-Paraffin: SFRS7 Antibody [NBP2-88251] - Rabbit Anti-SFRS7 antibody. Formalin Fixed Paraffin Embedded Tissue: Human Colon. Primary antibody Concentration: 1:200. Secondary Antibody: Donkey anti-Rabbit-Cy3. Secondary Antibody Concentration: 1:200. Magnification: 20x.

Applications for SFRS7 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: SFRS7

SFRS7 is required for pre-mRNA splicing. Can also modulate alternative splicing in vitro

Alternate Names

AAG3, aging-associated protein 3, arginine/serine-rich 7, 35kDa, HSSG1, RBM37, serine/arginine-rich splicing factor 7, SFRS7ZCRB2,9G8, Splicing factor 9G8, Splicing factor, arginine/serine-rich 7, splicing factor, arginine/serine-rich 7 (35kD), SR splicing factor 7, ZCCHC20

Gene Symbol

SRSF7

Additional SFRS7 Products

Product Documents for SFRS7 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for SFRS7 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for SFRS7 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review SFRS7 Antibody - BSA Free and earn rewards!

Have you used SFRS7 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...