SFRS9 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-57465

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all SFRS9 Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to SFRS9(splicing factor, arginine/serine-rich 9) The peptide sequence was selected from the middle region of SFRS9. Peptide sequence VCYADVQKDGVGMVEYLRKEDMEYALRKLDDTKFRSHEGETSYIRVYPER. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for SFRS9 Antibody - BSA Free

Western Blot: SFRS9 Antibody [NBP1-57465]

Western Blot: SFRS9 Antibody [NBP1-57465]

Western Blot: SFRS9 Antibody [NBP1-57465] - Sample Tissue: Human Fetal Lung Antibody Dilution: 1.0 ug/ml
Immunohistochemistry: SFRS9 Antibody [NBP1-57465]

Immunohistochemistry: SFRS9 Antibody [NBP1-57465]

Immunohistochemistry: SFRS9 Antibody [NBP1-57465] - Human Adult Lung Observed Staining: Cytoplasm in hepatocytes Primary Antibody Concentration: 1 : 600 Secondary Antibody: Donkey anti-Rabbit-Cy3 Secondary Antibody Concentration: 1 : 200 Magnification: 20X Exposure Time: 0.5 2.0 sec.
Western Blot: SFRS9 Antibody [NBP1-57465]

Western Blot: SFRS9 Antibody [NBP1-57465]

Western Blot: SFRS9 Antibody [NBP1-57465] - Human Placenta lysate, concentration 0.2-1 ug/ml.
Western Blot: SFRS9 Antibody [NBP1-57465]

Western Blot: SFRS9 Antibody [NBP1-57465]

Western Blot: SFRS9 Antibody [NBP1-57465] - Human Adult Placenta, Antibody Dilution: 1.0 ug/ml.

Applications for SFRS9 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: SFRS9

SFRS9 belongs to the splicing factor SR family. It contains 2 RRM (RNA recognition motif) domains. SFRS9 plays a role in constitutive splicing and can modulate the selection of alternative splice sites.

Alternate Names

Pre-mRNA-splicing factor SRp30C, serine/arginine-rich splicing factor 9, SFRS9, Splicing factor, arginine/serine-rich 9SR splicing factor 9, SRP30C

Gene Symbol

SRSF9

UniProt

Q13242 (Human)

Additional SFRS9 Products

Product Documents for SFRS9 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for SFRS9 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for SFRS9 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review SFRS9 Antibody - BSA Free and earn rewards!

Have you used SFRS9 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies