SGLT2/SLC5A2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-92384

Novus Biologicals
100% Guarantee

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Validated:

Human, Mouse, Canine, Tenrec

Cited:

Human, Mouse

Predicted:

Rat (91%). Backed by our 100% Guarantee.

Applications

Validated:

Immunohistochemistry, Immunohistochemistry-Paraffin, Immunocytochemistry/ Immunofluorescence

Cited:

Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence, IF/IHC

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all SGLT2/SLC5A2 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: FHEVGGYSGLFDKYLGAATSLTVSEDPAVGNISSFCYRPRPDSYHLL

Reactivity Notes

Use in Mouse reported in scientific literature (PMID:33712686). Canine reactivity reported from a verified customer review. Tenrec reactivity reported from a verified customer review.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for SGLT2/SLC5A2 Antibody - BSA Free

Immunohistochemistry-Paraffin: SGLT2/SLC5A2 Antibody [NBP1-92384]

Immunohistochemistry-Paraffin: SGLT2/SLC5A2 Antibody [NBP1-92384]

Immunohistochemistry-Paraffin: SGLT2/SLC5A2 Antibody [NBP1-92384] - SGLT2/SLC5A2 used at 1:50 on a tenrec kidney. SGLT2/SLC5A2 antibody was used on paraffin-embedded kidney tissue at a concentration of 20ug/mL and left at 4C overnight. HIER was performed in Citrate buffer (pH6) for two hours at 75C. Image from verified customer review.
Immunohistochemistry-Paraffin: SGLT2/SLC5A2 Antibody [NBP1-92384]

Immunohistochemistry-Paraffin: SGLT2/SLC5A2 Antibody [NBP1-92384]

Immunohistochemistry-Paraffin: SGLT2/SLC5A2 Antibody [NBP1-92384] - Staining of human lymph node shows no positivity in non-germinal center cells as expected.
Immunohistochemistry-Paraffin: SGLT2/SLC5A2 Antibody [NBP1-92384]

Immunohistochemistry-Paraffin: SGLT2/SLC5A2 Antibody [NBP1-92384]

Immunohistochemistry-Paraffin: SGLT2/SLC5A2 Antibody [NBP1-92384] - Staining of human kidney shows moderate positivity in apical membrane in cells in tubules.
Immunohistochemistry-Paraffin: SGLT2/SLC5A2 Antibody [NBP1-92384]

Immunohistochemistry-Paraffin: SGLT2/SLC5A2 Antibody [NBP1-92384]

Immunohistochemistry-Paraffin: SGLT2/SLC5A2 Antibody [NBP1-92384] - Analysis of SGLT2/SLC5A2 antibody on Canine kidney tissue. HIER was done in pH 6 (Citrate Buffer) for two hours at 75C, and primary antibody was put on at 1:100 overnight at 4C. Image was taken at 40X. Image from verified customer review.
SGLT2/SLC5A2 Antibody - BSA Free Immunohistochemistry: SGLT2/SLC5A2 Antibody - BSA Free [NBP1-92384]

Immunohistochemistry: SGLT2/SLC5A2 Antibody - BSA Free [NBP1-92384]

Staining of human endometrium shows no positivity in glandular cells as expected.
SGLT2/SLC5A2 Antibody - BSA Free Immunohistochemistry: SGLT2/SLC5A2 Antibody - BSA Free [NBP1-92384]

Immunohistochemistry: SGLT2/SLC5A2 Antibody - BSA Free [NBP1-92384]

Analysis in human kidney and endometrium tissues using NBP1-92384 antibody. Corresponding SLC5A2 RNA-seq data are presented for the same tissues.
SGLT2/SLC5A2 Antibody - BSA Free Immunohistochemistry: SGLT2/SLC5A2 Antibody - BSA Free [NBP1-92384]

Immunohistochemistry: SGLT2/SLC5A2 Antibody - BSA Free [NBP1-92384]

Staining of human cerebral cortex shows no positivity in neurons as expected.

Applications for SGLT2/SLC5A2 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

Reactivity reported in scientific literature (PMID: 25894829).

Immunohistochemistry

1:1000 - 1:2500

Immunohistochemistry-Paraffin

1:1000 - 1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Reviewed Applications

Read 2 reviews rated 4.5 using NBP1-92384 in the following applications:

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: SGLT2/SLC5A2

The SGLT2 gene encodes a member of the sodium glucose cotransporter family which are sodium-dependent glucose transport proteins. The encoded protein is the major cotransporter involved in glucose reabsorption in the kidney. Mutations in this gene are associat

Long Name

Solute Carrier Family 5 (Sodium/Glucose Cotransporter), Member 2

Alternate Names

SLC5A2

Gene Symbol

SLC5A2

Additional SGLT2/SLC5A2 Products

Product Documents for SGLT2/SLC5A2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for SGLT2/SLC5A2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for SGLT2/SLC5A2 Antibody - BSA Free

Customer Reviews for SGLT2/SLC5A2 Antibody - BSA Free (2)

4.5 out of 5
2 Customer Ratings
5 Stars
50%
4 Stars
50%
3 Stars
0%
2 Stars
0%
1 Stars
0%

Have you used SGLT2/SLC5A2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Customer Images

Showing  1 - 2 of 2 reviews Showing All
Filter By:
Clear Filters X
  • SGLT2/SLC5A2 Antibody
    Name: Vojtech Gabriel
    Application: Immunohistochemistry-Paraffin
    Sample Tested: IHC Sample Tested
    Species: Tenrec
    Verified Customer | Posted 05/11/2022
    SLC5A2 used at 1:50 on a tenrec kidney. SLC5A2 antibody was used on paraffin-embedded kidney tissue at a concentration of 20ug/mL and left at 4C overnight. HIER was performed in Citrate buffer (pH6) for two hours at 75C.
    SGLT2/SLC5A2 Antibody - BSA Free NBP1-92384
  • SGLT2/SLC5A2 Antibody
    Name: Anonymous
    Application: Immunohistochemistry-Paraffin
    Sample Tested: Kidney tissue
    Species: Canine
    Verified Customer | Posted 03/23/2022
    Canine Kidney, 1:100.
    Canine Kidney. HIER was done in pH 6 (Citrate Buffer) for two hours at 75C, and primary antibody was put on at 1:100 overnight at 4C. Image was taken at 40X.
    SGLT2/SLC5A2 Antibody - BSA Free NBP1-92384

There are no reviews that match your criteria.

Showing  1 - 2 of 2 reviews Showing All

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies