SHMT1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-85437

Novus Biologicals
Loading...

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: MTMPVNGAHKDADLWSSHDKMLAQPLKDSDVEVYNIIKKESNRQRVGLELIASENFASRAVLEALGSCL

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for SHMT1 Antibody - BSA Free

Immunohistochemistry-Paraffin: SHMT1 Antibody [NBP1-85437]

Immunohistochemistry-Paraffin: SHMT1 Antibody [NBP1-85437]

Immunohistochemistry-Paraffin: SHMT1 Antibody [NBP1-85437] - Staining in human kidney and skeletal muscle tissues using NBP1-85437 antibody. Corresponding SHMT1 RNA-seq data are presented for the same tissues.
Western Blot: SHMT1 Antibody [NBP1-85437]

Western Blot: SHMT1 Antibody [NBP1-85437]

Western Blot: SHMT1 Antibody [NBP1-85437] - Analysis in human kidney tissue.
Immunocytochemistry/ Immunofluorescence: SHMT1 Antibody [NBP1-85437]

Immunocytochemistry/ Immunofluorescence: SHMT1 Antibody [NBP1-85437]

Immunocytochemistry/Immunofluorescence: SHMT1 Antibody [NBP1-85437] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleus & cytosol.
Immunohistochemistry-Paraffin: SHMT1 Antibody [NBP1-85437]

Immunohistochemistry-Paraffin: SHMT1 Antibody [NBP1-85437]

Immunohistochemistry-Paraffin: SHMT1 Antibody [NBP1-85437] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.
Immunohistochemistry-Paraffin: SHMT1 Antibody [NBP1-85437]

Immunohistochemistry-Paraffin: SHMT1 Antibody [NBP1-85437]

Immunohistochemistry-Paraffin: SHMT1 Antibody [NBP1-85437] - Staining of human liver shows strong cytoplasmic positivity in hepatocytes.
Immunohistochemistry-Paraffin: SHMT1 Antibody [NBP1-85437]

Immunohistochemistry-Paraffin: SHMT1 Antibody [NBP1-85437]

Immunohistochemistry-Paraffin: SHMT1 Antibody [NBP1-85437] - Staining of human skeletal muscle shows no positivity in myocytes as expected.
Immunohistochemistry-Paraffin: SHMT1 Antibody [NBP1-85437]

Immunohistochemistry-Paraffin: SHMT1 Antibody [NBP1-85437]

Immunohistochemistry-Paraffin: SHMT1 Antibody [NBP1-85437] - Staining of human testis shows moderate to strong cytoplasmic positivity in cells in seminiferous ducts.

Applications for SHMT1 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25 - 2 ug/mL

Immunohistochemistry

1:500 - 1:1000

Immunohistochemistry-Paraffin

1:500 - 1:1000

Western Blot

0.04 - 0.4 ug/mL
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.

Reviewed Applications

Read 1 review rated 4 using NBP1-85437 in the following applications:

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: SHMT1

SHMT1 encodes the cellular form of serine hydroxymethyltransferase, a pyridoxal phosphate-containing enzyme that catalyzes the reversible conversion of serine and tetrahydrofolate to glycine and 5,10-methylene tetrahydrofolate. This reaction provides one carbon units for synthesis of methionine, thymidylate, and purines in the cytoplasm. This gene is located within the Smith-Magenis syndrome region on chromosome 17. Alternative splicing of this gene results in 2 transcript variants encoding 2 different isoforms. Additional transcript variants have been described, but their biological validity has not been determined.

Long Name

Serine hydroxymethyltransferase, cytosolic

Alternate Names

EC 2.1.2.1, Serine methylase, SHMT

Gene Symbol

SHMT1

Additional SHMT1 Products

Product Documents for SHMT1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for SHMT1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for SHMT1 Antibody - BSA Free

Customer Reviews for SHMT1 Antibody - BSA Free (1)

4 out of 5
1 Customer Rating
5 Stars
0%
4 Stars
100%
3 Stars
0%
2 Stars
0%
1 Stars
0%

Have you used SHMT1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Customer Images


Showing  1 - 1 of 1 review Showing All
Filter By:
  • SHMT1 Antibody
    Name: Hua Jiang
    Application: Western Blot
    Sample Tested: Liver
    Species: Human
    Verified Customer | Posted 08/16/2021
    SHMT1-Reveiw-2021
    SHMT1 Antibody - BSA Free NBP1-85437
    Bio-Techne Response
    This review was submitted through the legacy Novus Innovators Program, reflecting a new species or application tested on a primary antibody.

There are no reviews that match your criteria.

Showing  1 - 1 of 1 review Showing All

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...