SHMT1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-17022

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all SHMT1 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: LQIQSDTGVRATLKEFKERLAGDKYQAAVQALREEVESFASLFPLPGLPDF

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for SHMT1 Antibody - BSA Free

Immunohistochemistry-Paraffin: SHMT1 Antibody [NBP3-17022]

Immunohistochemistry-Paraffin: SHMT1 Antibody [NBP3-17022]

Immunohistochemistry-Paraffin: SHMT1 Antibody [NBP3-17022] - Analysis in human liver and cerebral cortex tissues using Anti-SHMT1 antibody. Corresponding SHMT1 RNA-seq data are presented for the same tissues.
Western Blot: SHMT1 Antibody [NBP3-17022]

Western Blot: SHMT1 Antibody [NBP3-17022]

Western Blot: SHMT1 Antibody [NBP3-17022] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10; Lane 2: RT4; Lane 3: U-251 MG; Lane 4: Human Plasma; Lane 5: Liver; Lane 6: Tonsil
Immunohistochemistry-Paraffin: SHMT1 Antibody [NBP3-17022]

Immunohistochemistry-Paraffin: SHMT1 Antibody [NBP3-17022]

Immunohistochemistry-Paraffin: SHMT1 Antibody [NBP3-17022] - Staining of human cerebral cortex shows low expression as expected.
Immunohistochemistry-Paraffin: SHMT1 Antibody [NBP3-17022]

Immunohistochemistry-Paraffin: SHMT1 Antibody [NBP3-17022]

Immunohistochemistry-Paraffin: SHMT1 Antibody [NBP3-17022] - Staining of human liver shows high expression.

Applications for SHMT1 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:20 - 1:50

Immunohistochemistry-Paraffin

1:20 - 1:50

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: SHMT1

SHMT1 encodes the cellular form of serine hydroxymethyltransferase, a pyridoxal phosphate-containing enzyme that catalyzes the reversible conversion of serine and tetrahydrofolate to glycine and 5,10-methylene tetrahydrofolate. This reaction provides one carbon units for synthesis of methionine, thymidylate, and purines in the cytoplasm. This gene is located within the Smith-Magenis syndrome region on chromosome 17. Alternative splicing of this gene results in 2 transcript variants encoding 2 different isoforms. Additional transcript variants have been described, but their biological validity has not been determined.

Long Name

Serine hydroxymethyltransferase, cytosolic

Alternate Names

EC 2.1.2.1, Serine methylase, SHMT

Gene Symbol

SHMT1

Additional SHMT1 Products

Product Documents for SHMT1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for SHMT1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for SHMT1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review SHMT1 Antibody - BSA Free and earn rewards!

Have you used SHMT1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies