SHMT2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-80755

Novus Biologicals
Loading...

Key Product Details

Validated by

Orthogonal Validation, Independent Antibodies

Species Reactivity

Validated:

Human, Mouse, Rat

Cited:

Human

Applications

Validated:

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Cited:

Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: GQLVRMAIRAQHSNAAQTQTGEANRGWTGQESLSDSDPEMWELLQREKDRQCRGLELIASENFCSRAALEAL

Reactivity Notes

Reactivity reported in scientific literature (PMID: 24498411).

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for SHMT2 Antibody - BSA Free

Immunohistochemistry-Paraffin: SHMT2 Antibody [NBP1-80755]

Immunohistochemistry-Paraffin: SHMT2 Antibody [NBP1-80755]

Immunohistochemistry-Paraffin: SHMT2 Antibody [NBP1-80755] - Analysis in human liver and skeletal muscle tissues using NBP1-80755 antibody. Corresponding SHMT2 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: SHMT2 Antibody [NBP1-80755]

Immunohistochemistry-Paraffin: SHMT2 Antibody [NBP1-80755]

Immunohistochemistry-Paraffin: SHMT2 Antibody [NBP1-80755] - Staining of human duodenum, liver, lymph node and skeletal muscle using Anti-SHMT2 antibody NBP1-80755 (A) shows similar protein distribution across tissues to independent antibody NBP1-80754 (B).
Western Blot: SHMT2 Antibody [NBP1-80755]

Western Blot: SHMT2 Antibody [NBP1-80755]

Western Blot: SHMT2 Antibody [NBP1-80755] - Analysis using Anti-SHMT2 antibody NBP1-80755 (A) shows similar pattern to independent antibody NBP1-80754 (B).
Immunocytochemistry/ Immunofluorescence: SHMT2 Antibody [NBP1-80755]

Immunocytochemistry/ Immunofluorescence: SHMT2 Antibody [NBP1-80755]

Immunocytochemistry/Immunofluorescence: SHMT2 Antibody [NBP1-80755] - Staining of human cell line U-2 OS shows localization to mitochondria & microtubules. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: SHMT2 Antibody [NBP1-80755]

Immunohistochemistry-Paraffin: SHMT2 Antibody [NBP1-80755]

Immunohistochemistry-Paraffin: SHMT2 Antibody [NBP1-80755] - Staining of human skeletal muscle shows no positivity in myocytes as expected.
Western Blot: SHMT2 Antibody [NBP1-80755]

Western Blot: SHMT2 Antibody [NBP1-80755]

Western Blot: SHMT2 Antibody [NBP1-80755] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Immunohistochemistry-Paraffin: SHMT2 Antibody [NBP1-80755]

Immunohistochemistry-Paraffin: SHMT2 Antibody [NBP1-80755]

Immunohistochemistry-Paraffin: SHMT2 Antibody [NBP1-80755] - Staining of human liver shows moderate granular cytoplasmic positivity in hepatocytes.
Immunohistochemistry-Paraffin: SHMT2 Antibody [NBP1-80755]

Immunohistochemistry-Paraffin: SHMT2 Antibody [NBP1-80755]

Immunohistochemistry-Paraffin: SHMT2 Antibody [NBP1-80755] - Staining of human lymph node shows moderate granular cytoplasmic positivity in non-germinal center cells.
Immunohistochemistry-Paraffin: SHMT2 Antibody [NBP1-80755]

Immunohistochemistry-Paraffin: SHMT2 Antibody [NBP1-80755]

Immunohistochemistry-Paraffin: SHMT2 Antibody [NBP1-80755] - Staining of human duodenum shows moderate granular cytoplasmic positivity in glandular cells.
SHMT2 Antibody - BSA Free

Western Blot: SHMT2 Antibody - BSA Free [NBP1-80755] -

CQ sensitizes PDXs with low SHMT2 expression to 5-FU treatment.A Images of immunohistochemical staining for SHMT2, LC3, and p62 in CRC tissues from four selected patients (two with low SHMT2 expression and two with high SHMT2 expression) using the indicated antibodies. Scale bar, 50 μm. B Schematic of PDX model establishment. C–E Xenograft experiments with 5-FU or CQ treatment are described in the Methods section. C Xenograft tumors were harvested and photographed. D, E Quantification of the average volumes (D) and weights (E) of the xenograft tumors are shown. Four tumors from individual mice were included in each group; *P < 0.05, **P < 0.01. F Representative western blot of xenograft tumors. G Schematic diagram showing the basic hypothesis/conclusion/model. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/33990700), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
SHMT2 Antibody - BSA Free

Western Blot: SHMT2 Antibody - BSA Free [NBP1-80755] -

5-FU resistance is related to low SHMT2 expression and autophagy in CRC.A Expression of SHMT2 in three GEO datasets (GSE39582, GSE24551, and GSE21510). ***P < 0.001. B Representative images of immunohistochemical staining for SHMT2 in peritumor and CRC tissues. Scale bar, 50 μm. C 378 stage II–III paired CRC tissues assessed by immunohistochemistry are shown. **P < 0.01. D Survival of patients stratified by the SHMT2 expression level. DFS and OS of patients with stage II–III disease treated with 5-FU-based chemotherapy stratified by the SHMT2 expression level. E, F The protein levels of endogenous SHMT2, p62, LC3, and beta -actin (as the internal standard) were examined by western blotting in CRC tissues. F The Spearman rank correlation test was used to evaluate correlations between the SHMT2, p62, and LC3 expression status in CRC tissues as determined by western blotting. G Representative images of immunohistochemical staining. Scale bar, 50 μm. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/33990700), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
SHMT2 Antibody - BSA Free

Western Blot: SHMT2 Antibody - BSA Free [NBP1-80755] -

Inhibition of autophagy induced by low SHMT2 expression sensitizes CRC cells to 5-FU treatment.A SHMT2 promoted apoptosis and inhibited autophagy in response to 5-FU treatment. Western blot analysis of lysates of HCT116 cells that were transfected with SHMT2 or infected with SHMT2-sh lentivirus and treated with 5-FU (10 μM) for 24 h. The protein levels of SHMT2, p62, LC3, cleaved Caspase 3, PARP, and beta -actin (as the internal standard) were assessed with the indicated antibodies. B The protein levels of SHMT2, p62, LC3, cleaved Caspase 3, PARP, and beta -actin (as the internal standard) were assessed in SHMT2-KO HCT116 cells. C The indicated cells were treated with 5-FU (2 μM), 3-MA (10 mM) or chloroquine diphosphate salt (CQ, 20 μM) for 4 days and analyzed using the MTT cell viability assay. *P < 0.05, **P < 0.01. D–F The xenograft experiment with Control and SHMT2-sh cells treated with 5-FU or CQ is described in the Methods section. D Xenograft tumors were harvested and photographed. E, F Quantification of the average volumes (E) and weights (F) of the xenograft tumors are shown. Five tumors from individual mice were included in each group; *P < 0.05, **P < 0.01. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/33990700), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
SHMT2 Antibody - BSA Free

Western Blot: SHMT2 Antibody - BSA Free [NBP1-80755] -

Inhibition of autophagy induced by low SHMT2 expression sensitizes CRC cells to 5-FU treatment.A SHMT2 promoted apoptosis and inhibited autophagy in response to 5-FU treatment. Western blot analysis of lysates of HCT116 cells that were transfected with SHMT2 or infected with SHMT2-sh lentivirus and treated with 5-FU (10 μM) for 24 h. The protein levels of SHMT2, p62, LC3, cleaved Caspase 3, PARP, and beta -actin (as the internal standard) were assessed with the indicated antibodies. B The protein levels of SHMT2, p62, LC3, cleaved Caspase 3, PARP, and beta -actin (as the internal standard) were assessed in SHMT2-KO HCT116 cells. C The indicated cells were treated with 5-FU (2 μM), 3-MA (10 mM) or chloroquine diphosphate salt (CQ, 20 μM) for 4 days and analyzed using the MTT cell viability assay. *P < 0.05, **P < 0.01. D–F The xenograft experiment with Control and SHMT2-sh cells treated with 5-FU or CQ is described in the Methods section. D Xenograft tumors were harvested and photographed. E, F Quantification of the average volumes (E) and weights (F) of the xenograft tumors are shown. Five tumors from individual mice were included in each group; *P < 0.05, **P < 0.01. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/33990700), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
SHMT2 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: SHMT2 Antibody - BSA Free [NBP1-80755] -

SHMT2 interacts with cytosolic p53.A, B SHMT2 purified by Flag-IP was collected after in-gel digestion and used for LC-MS/MS analysis to search for the binding proteins of SHMT2. A Flag-SHMT2 was transfected into 293 T cells for 24 h, isolated by coimmunoprecipitation, separated by SDS-PAGE and stained using Coomassie. B Tabular display of the number of tryptic peptides from each of the indicated proteins that coprecipitated with SHMT2. C HCT116 cells transfected with Flag-SHMT2 were immunoprecipitated with FLAG-M2 beads. Western blotting for p53 and SHMT2 was then performed. Immunoprecipitation using an anti-p53 antibody (Do-1) was followed by western blotting with anti-SHMT2 or anti-p53 antibodies (ab32389, Abcam). D SHMT2 interacted mainly with endogenous cytosolic p53 in HCT116 cells. Cyt cytosolic, Nuc nuclear. E Cytosolic p53 bound to SHMT2. HCT116 cells transfected with Flag-WT, nuclear (NES-) or cytosolic p53 (NLS-) were immunoprecipitated with FLAG-M2 beads. Western blotting for FLAG and SHMT2 was then performed. F–H Colocalization of SHMT2 and cytosolic p53. A set of partially enlarged pictures are attached on the right side. F Representative micrographs of HCT116 cells transfected with plasmids expressing WT, nuclear (NES-) and cytosolic p53 (NLS-). G Representative micrographs of HCT116 cells stained for SHMT2 and p53. H Representative micrographs of HCT116 cells in the proximity ligation assay (PLA). Scale bar, 10 μm. PLA foci per nucleus for the two antibodies are presented in the histogram. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/33990700), licensed under a CC-BY license. Not internally tested by Novus Biologicals.

Applications for SHMT2 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:500 - 1:1000

Immunohistochemistry-Paraffin

1:500 - 1:1000

Western Blot

0.04 - 0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: SHMT2

The SHMT2 gene encodes the mitochondrial form of a pyridoxal phosphate-dependent enzyme that catalyzes the reversible reaction of serine and tetrahydrofolate to glycine and 5,10-methylene tetrahydrofolate. The encoded product is primarily responsible for glyci

Long Name

Serine hydroxymethyltransferase, mitochondrial

Alternate Names

EC 2.1.2.1, GLY A+, GLYA, glycine auxotroph A, human complement for hamster, Glycine hydroxymethyltransferase, serine aldolase, serine hydroxymethylase, serine hydroxymethyltransferase 2 (mitochondrial), serine hydroxymethyltransferase, mitochondrial, Serine methylase, SHMT, threonine aldolase

Entrez Gene IDs

6472 (Human)

Gene Symbol

SHMT2

UniProt

Additional SHMT2 Products

Product Documents for SHMT2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for SHMT2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for SHMT2 Antibody - BSA Free

Customer Reviews for SHMT2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review SHMT2 Antibody - BSA Free and earn rewards!

Have you used SHMT2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...