Sigma-1 R/OPRS1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-82479

Novus Biologicals
Loading...

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Validated:

Human, Rat

Cited:

Human, Rat

Predicted:

Mouse (98%). Backed by our 100% Guarantee.

Applications

Validated:

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Simple Western

Cited:

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: FVFQREEIAQLARQYAGLDHELAFSRLIVELRRLHPGHVLPDEELQWVFVNAGG

Reactivity Notes

Use in Rat reported in scientific literature (PMID:35040378).

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

Novus Biologicals Rabbit Sigma-1 R/OPRS1 Antibody - BSA Free (NBP1-82479) is a polyclonal antibody validated for use in IHC, WB and Simple Western. Anti-Sigma-1 R/OPRS1 Antibody: Cited in 4 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.

Scientific Data Images for Sigma-1 R/OPRS1 Antibody - BSA Free

Western Blot: Sigma-1 R/OPRS1 Antibody [NBP1-82479]

Western Blot: Sigma-1 R/OPRS1 Antibody [NBP1-82479]

Western Blot: Sigma-1 R/OPRS1 Antibody [NBP1-82479] - Analysis in human cell lines PC-3 and MCF-7 using Anti-SIGMAR1 antibody. Corresponding SIGMAR1 RNA-seq data are presented for the same cell lines. Loading control: Anti-PPIB.
Immunohistochemistry-Paraffin: Sigma-1 R/OPRS1 Antibody [NBP1-82479]

Immunohistochemistry-Paraffin: Sigma-1 R/OPRS1 Antibody [NBP1-82479]

Immunohistochemistry-Paraffin: Sigma-1 R/OPRS1 Antibody [NBP1-82479] - Staining of human gastrointestinal shows moderate cytoplasmic and membranous positivity in glandular cells.
Immunohistochemistry-Paraffin: Sigma-1 R/OPRS1 Antibody [NBP1-82479]

Immunohistochemistry-Paraffin: Sigma-1 R/OPRS1 Antibody [NBP1-82479]

Immunohistochemistry-Paraffin: Sigma-1 R/OPRS1 Antibody [NBP1-82479] - Staining of human liver shows strong cytoplasmic positivity in hepatocytes.
Immunohistochemistry-Paraffin: Sigma-1 R/OPRS1 Antibody [NBP1-82479]

Immunohistochemistry-Paraffin: Sigma-1 R/OPRS1 Antibody [NBP1-82479]

Immunohistochemistry-Paraffin: Sigma-1 R/OPRS1 Antibody [NBP1-82479] - Staining of human Fallopian tube shows moderate cytoplasmic and membranous positivity in glandular cells.
Immunohistochemistry-Paraffin: Sigma-1 R/OPRS1 Antibody [NBP1-82479]

Immunohistochemistry-Paraffin: Sigma-1 R/OPRS1 Antibody [NBP1-82479]

Immunohistochemistry-Paraffin: Sigma-1 R/OPRS1 Antibody [NBP1-82479] - Staining of human cerebellum shows strong cytoplasmic positivity in Purkinje cells.
Simple Western: Sigma-1 R/OPRS1 Antibody [NBP1-82479]

Simple Western: Sigma-1 R/OPRS1 Antibody [NBP1-82479]

Simple Western: Sigma-1 R/OPRS1 Antibody [NBP1-82479] - Simple Western lane view shows a specific band for SIGMAR1 in 0.2 mg/ml of Liver (left), RT-4 (right) lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation system.
Simple Western: Sigma-1 R/OPRS1 Antibody [NBP1-82479]

Simple Western: Sigma-1 R/OPRS1 Antibody [NBP1-82479]

Simple Western: Sigma-1 R/OPRS1 Antibody [NBP1-82479] - Electropherogram image(s) of corresponding Simple Western lane view. Sigma-1 R/OPRS1 antibody was used at 1:20 dilution on Liver lysate(s).
Simple Western: Sigma-1 R/OPRS1 Antibody [NBP1-82479]

Simple Western: Sigma-1 R/OPRS1 Antibody [NBP1-82479]

Simple Western: Sigma-1 R/OPRS1 Antibody [NBP1-82479] - Electropherogram image(s) of corresponding Simple Western lane view. Sigma-1 R/OPRS1 antibody was used at 1:20 dilution on RT-4 lysate(s).

Applications for Sigma-1 R/OPRS1 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:20 - 1:50

Immunohistochemistry-Paraffin

1:20 - 1:50

Simple Western

1:20

Western Blot

0.04-0.4 ug/ml
Application Notes

For IHC-Paraffin, HIER pH 6 retrieval is recommended.

In Simple Western only 10 - 15 uL of the recommended dilution is used per data point.
See Simple Western Antibody Database for Simple Western validation: Tested in Liver, RT-4, separated by Size, antibody dilution of 1:20, apparent MW was 29 kDa. Separated by Size-Wes, Sally Sue/Peggy Sue.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Sigma-1 R

OPRS1 encodes a receptor protein that interacts with a variety of psychotomimetic drugs, including cocaine and amphetamines. The receptor is believed to play an important role in the cellular functions of various tissues associated with the endocrine, immune, and nervous systems. As indicated by its previous name, opioid receptor sigma 1 (OPRS1), the product of this gene was erroneously thought to function as an opioid receptor; it is now thought to be a non-opioid receptor. Alternative splicing of this gene results in transcript variants encoding distinct isoforms. [provided by RefSeq]. Transcript Variant: This variant (1) encodes the longest isoform (1). Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Long Name

Sigma Non-opioid Intracellular Receptor 1

Alternate Names

ALS16, OPRS1, SIG-1R, Sigma-1R, Sigma1R, SIGMAR1, SRBP

Gene Symbol

SIGMAR1

Additional Sigma-1 R Products

Product Documents for Sigma-1 R/OPRS1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Sigma-1 R/OPRS1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for Sigma-1 R/OPRS1 Antibody - BSA Free

Customer Reviews for Sigma-1 R/OPRS1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Sigma-1 R/OPRS1 Antibody - BSA Free and earn rewards!

Have you used Sigma-1 R/OPRS1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...