Signal peptide peptidase-like 2B Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-55073

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Validated:

Human

Predicted:

Mouse (97%), Rat (90%). Backed by our 100% Guarantee.

Applications

Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all Signal peptide peptidase-like 2B Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: YWAGSRDVKKRYMKHKRDDGPEKQEDEAVDV

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Signal peptide peptidase-like 2B Antibody - BSA Free

Western Blot: Signal peptide peptidase-like 2B Antibody [NBP2-55073]

Western Blot: Signal peptide peptidase-like 2B Antibody [NBP2-55073]

Western Blot: Signal peptide peptidase-like 2B Antibody [NBP2-55073] - Western blot analysis in human cell line RT-4 and human cell line U-251 MG.
Immunocytochemistry/ Immunofluorescence: Signal peptide peptidase-like 2B Antibody [NBP2-55073]

Immunocytochemistry/ Immunofluorescence: Signal peptide peptidase-like 2B Antibody [NBP2-55073]

Immunocytochemistry/Immunofluorescence: Signal peptide peptidase-like 2B Antibody [NBP2-55073] - Staining of human cell line SiHa shows localization to nucleoplasm, plasma membrane & centrosome.

Applications for Signal peptide peptidase-like 2B Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Western Blot

0.04-0.4 ug/ml
Application Notes
ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Signal peptide peptidase-like 2B

The Signal peptide peptidase-like 2B gene encodes a member of the GXGD family of aspartic proteases. The GXGD proteases are transmembrane proteins withtwo conserved catalytic motifs localized within the membrane-spanning regions. This enzyme localizes to endosomes,lysosomes, and the pla

Alternate Names

EC 3.4.23, EC 3.4.23.-, IMP-4, IMP4MGC111084, Intramembrane protease 4, KIAA1532signal peptide peptidase-like 2B, Presenilin-like protein 1, PSL1, SNPPL2B, SPPL2b, SPP-like 2B

Gene Symbol

SPPL2B

Additional Signal peptide peptidase-like 2B Products

Product Documents for Signal peptide peptidase-like 2B Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Signal peptide peptidase-like 2B Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Signal peptide peptidase-like 2B Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Signal peptide peptidase-like 2B Antibody - BSA Free and earn rewards!

Have you used Signal peptide peptidase-like 2B Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies