SLC1A5 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-89327

Novus Biologicals
100% Guarantee

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Validated:

Human, Mouse, Porcine

Cited:

Human, Mouse, Porcine

Applications

Validated:

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Cited:

Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence, Proximity Ligation Assay, IF/IHC

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all SLC1A5 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: VDRTESRSTEPELIQVKSELPLDPLPVPTEEGNPLLKHYRGPAGDATVASEKESVM

Reactivity Notes

Use in Porcine reported in scientific literature (PMID:34488623). Mouse reactivity reported in scientific literature (PMID: 31387898).

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for SLC1A5 Antibody - BSA Free

Immunohistochemistry-Paraffin: SLC1A5 Antibody [NBP1-89327]

Immunohistochemistry-Paraffin: SLC1A5 Antibody [NBP1-89327]

Immunohistochemistry-Paraffin: SLC1A5 Antibody [NBP1-89327] - Staining in human prostate and skeletal muscle tissues. Corresponding SLC1A5 RNA-seq data are presented for the same tissues.
Western Blot: SLC1A5 Antibody [NBP1-89327]

Western Blot: SLC1A5 Antibody [NBP1-89327]

Western Blot: SLC1A5 Antibody [NBP1-89327] - Analysis in human cell line NB4.
Immunocytochemistry/ Immunofluorescence: SLC1A5 Antibody [NBP1-89327]

Immunocytochemistry/ Immunofluorescence: SLC1A5 Antibody [NBP1-89327]

Immunocytochemistry/Immunofluorescence: SLC1A5 Antibody [NBP1-89327] - Staining of human cell line A-431 shows localization to plasma membrane. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: SLC1A5 Antibody [NBP1-89327]

Immunohistochemistry-Paraffin: SLC1A5 Antibody [NBP1-89327]

Immunohistochemistry-Paraffin: SLC1A5 Antibody [NBP1-89327] - Staining in human hepatocellular carcinoma. Image from a verified customer review.
Western Blot: SLC1A5 Antibody [NBP1-89327]

Western Blot: SLC1A5 Antibody [NBP1-89327]

Western Blot: SLC1A5 Antibody [NBP1-89327] - Analysis in control (vector only transfected HEK293T lysate) and SLC1A5 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunohistochemistry-Paraffin: SLC1A5 Antibody [NBP1-89327]

Immunohistochemistry-Paraffin: SLC1A5 Antibody [NBP1-89327]

Immunohistochemistry-Paraffin: SLC1A5 Antibody [NBP1-89327] - Staining of human placenta shows strong membranous positivity in trophoblastic cells.
Immunohistochemistry-Paraffin: SLC1A5 Antibody [NBP1-89327]

Immunohistochemistry-Paraffin: SLC1A5 Antibody [NBP1-89327]

Immunohistochemistry-Paraffin: SLC1A5 Antibody [NBP1-89327] - Staining of human prostate shows strong membranous positivity in glandular cells.
Immunohistochemistry-Paraffin: SLC1A5 Antibody [NBP1-89327]

Immunohistochemistry-Paraffin: SLC1A5 Antibody [NBP1-89327]

Immunohistochemistry-Paraffin: SLC1A5 Antibody [NBP1-89327] - Staining of human rectum shows moderate to strong membranous positivity in glandular cells.
Immunohistochemistry-Paraffin: SLC1A5 Antibody [NBP1-89327]

Immunohistochemistry-Paraffin: SLC1A5 Antibody [NBP1-89327]

Immunohistochemistry-Paraffin: SLC1A5 Antibody [NBP1-89327] - Staining of human skeletal muscle shows no positivity in striated muscle fibers as expected.
SLC1A5 Antibody - BSA Free

Immunohistochemistry: SLC1A5 Antibody - BSA Free [NBP1-89327] -

Association between expression levels of GLUT1 and ASCT2 and tumor size.(A) IHC staining for GLUT1 and ASCT2 in patients with tumor diameter less or more than 5 cm. The scale bar indicates 100 μm. (B-C) The IHC H-scores for GLUT1 (B) and ASCT2 (C) in patients with tumor diameter less or more than 5 cm. The IHC H-scores are expressed as mean +/- standard error of mean (bars); ** represents p < 0.01. (D) GLUT1 expression level is positively correlated with ASCT2 expression (n = 192). Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/28036362), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
SLC1A5 Antibody - BSA Free

Immunohistochemistry: SLC1A5 Antibody - BSA Free [NBP1-89327] -

Significantly elevated GLUT1 and ASCT2 expression levels in hepatocellular carcinoma (HCC).(A–B) Immunohistochemistry (IHC) assays of GLUT1 (A) and ASCT2 (B) expression in tumor (T) and adjacent non-tumor tissues (N). The scale bar indicates 50 μm. (C-D) GLUT1 (C) and ASCT2 (D) expression levels in tumor (T) tissue are significantly higher than those in adjacent non-tumor tissue (N) (n = 15). The IHC H-scores are shown as a box-plot; ** indicates p < 0.01. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/28036362), licensed under a CC-BY license. Not internally tested by Novus Biologicals.

Applications for SLC1A5 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:500 - 1:1000

Immunohistochemistry-Paraffin

1:500 - 1:1000

Western Blot

0.04-0.4 ug/ml
Application Notes
IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.

Reviewed Applications

Read 1 review rated 5 using NBP1-89327 in the following applications:

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: SLC1A5

SLC1A5 has a broad substrate specificity, a preference for zwitterionic amino acids, and a sodium-dependence. It accepts as substrates all neutral amino acids, including glutamine, asparagine, and branched-chain and aromatic amino acids, and excludes methylated

Long Name

SLC1A5

Alternate Names

AAAT, ASCT2, ATBO, baboon M7 virus receptor, M7V1, M7VS1, R16, RD114 virus receptor, RDRC

Entrez Gene IDs

6510 (Human)

Gene Symbol

Q15758

UniProt

Q15758 (Human)

Additional SLC1A5 Products

Product Documents for SLC1A5 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for SLC1A5 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for SLC1A5 Antibody - BSA Free

Customer Reviews for SLC1A5 Antibody - BSA Free (1)

5 out of 5
1 Customer Rating
5 Stars
100%
4 Stars
0%
3 Stars
0%
2 Stars
0%
1 Stars
0%

Have you used SLC1A5 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Customer Images

Showing  1 - 1 of 1 review Showing All
Filter By:
Clear Filters X
  • SLC1A5 Antibody
    Name: Anonymous
    Application: Immunohistochemistry
    Sample Tested: Hepatocellular Carcinoma
    Species: Human
    Verified Customer | Posted 07/11/2017
    The expression of SLC1A5 in human hepatocellular carcinoma
    SLC1A5 Antibody - BSA Free NBP1-89327

There are no reviews that match your criteria.

Showing  1 - 1 of 1 review Showing All

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies