SLC25A11 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-38512

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all SLC25A11 Primary Antibodies »

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 1-100 of human SLC25A11 (NP_003553.2).

Sequence:
MAATASAGAGGIDGKPRTSPKSVKFLFGGLAGMGATVFVQPLDLVKNRMQLSGEGAKTREYKTSFHALTSILKAEGLRGIYTGLSAGLLRQATYTTTRLGIYTVLFERLTGADGTPPGFLLKAVIGMTAGATGAFVGTPAEVALIRMTADGRLPADQRRGYKNVFNALIRITREEGVLTLWRGCIPTMARAVVVNAAQLASYSQSKQFLLDSGYFSDNILCHFCASMISGLVTTAASMPVDIAKTRIQNMRMIDGKPEYKNGLDVLFKVVRYEGFFSLWKGFTPYYARLGPHTVLTFIFLEQMNKAYKRLFLSG

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

34 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for SLC25A11 Antibody - BSA Free

SLC25A11 Antibody

Immunohistochemistry: SLC25A11 Antibody [NBP3-38512] -

Immunohistochemistry: SLC25A11 Antibody [NBP3-38512] - Immunohistochemistry analysis of paraffin-embedded Rat spleen using SLC25A11 Rabbit pAb at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.
SLC25A11 Antibody

Immunohistochemistry: SLC25A11 Antibody [NBP3-38512] -

Immunohistochemistry: SLC25A11 Antibody [NBP3-38512] - Immunohistochemistry analysis of paraffin-embedded Human colon carcinoma using SLC25A11 Rabbit pAb at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.
SLC25A11 Antibody

Immunocytochemistry/ Immunofluorescence: SLC25A11 Antibody [NBP3-38512] -

Immunocytochemistry/ Immunofluorescence: SLC25A11 Antibody [NBP3-38512] - Immunofluorescence analysis of NIH/3T3 cells using SLC25A11 Rabbit pAb at dilution of 1:300 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
SLC25A11 Antibody

Western Blot: SLC25A11 Antibody [NBP3-38512] -

Western Blot: SLC25A11 Antibody [NBP3-38512] - Western blot analysis of various lysates, using SLC25A11 Rabbit pAb at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 10s.
SLC25A11 Antibody

Immunohistochemistry: SLC25A11 Antibody [NBP3-38512] -

Immunohistochemistry: SLC25A11 Antibody [NBP3-38512] - Immunohistochemistry analysis of paraffin-embedded Mouse spinal cord using SLC25A11 Rabbit pAb at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.
SLC25A11 Antibody

Immunohistochemistry: SLC25A11 Antibody [NBP3-38512] -

Immunohistochemistry: SLC25A11 Antibody [NBP3-38512] - Immunohistochemistry analysis of paraffin-embedded Human gastric cancer using SLC25A11 Rabbit pAb at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.

Applications for SLC25A11 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:100 - 1:500

Immunohistochemistry-Paraffin

1:50 - 1:100

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: SLC25A11

SLC25A11 (Solute carrier family 25 member 11) is an oxoglutarate carrier. It catalyzes the transport of 2-oxoglutarate across the inner mitochondrial membrane in an electroneutral exchange for malate or other dicarboxylic acids.

Alternate Names

OGCmitochondrial 2-oxoglutarate/malate carrier protein, OGCP, SLC20A4solute carrier family 20 (oxoglutarate carrier), member 4, solute carrier family 25 (mitochondrial carrier; oxoglutarate carrier), member11, Solute carrier family 25 member 11

Gene Symbol

SLC25A11

Additional SLC25A11 Products

Product Documents for SLC25A11 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for SLC25A11 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for SLC25A11 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review SLC25A11 Antibody - BSA Free and earn rewards!

Have you used SLC25A11 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies