SLC25A12 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-89020

Novus Biologicals
100% Guarantee

Key Product Details

Validated by

Independent Antibodies

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all SLC25A12 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: FNWDCEFIRLHFGHNRKKHLNYTEFTQFLQELQLEHARQAFALKDKSKSGMISGLDFSDIMV

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for SLC25A12 Antibody - BSA Free

Western Blot: SLC25A12 Antibody [NBP1-89020]

Western Blot: SLC25A12 Antibody [NBP1-89020]

Western Blot: SLC25A12 Antibody [NBP1-89020] - Analysis using Anti-SLC25A12 antibody NBP1-89020 (A) shows similar pattern to independent antibody NBP2-38249 (B).
Immunohistochemistry-Paraffin: SLC25A12 Antibody [NBP1-89020]

Immunohistochemistry-Paraffin: SLC25A12 Antibody [NBP1-89020]

Immunohistochemistry-Paraffin: SLC25A12 Antibody [NBP1-89020] - Staining of human skeletal muscle shows weak cytoplasmic positivity in myocytes.
Western Blot: SLC25A12 Antibody [NBP1-89020]

Western Blot: SLC25A12 Antibody [NBP1-89020]

Western Blot: SLC25A12 Antibody [NBP1-89020] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunohistochemistry-Paraffin: SLC25A12 Antibody [NBP1-89020]

Immunohistochemistry-Paraffin: SLC25A12 Antibody [NBP1-89020]

Immunohistochemistry-Paraffin: SLC25A12 Antibody [NBP1-89020] - Staining of human cerebral cortex shows strong cytoplasmic positivity in neurons.
Immunohistochemistry-Paraffin: SLC25A12 Antibody [NBP1-89020]

Immunohistochemistry-Paraffin: SLC25A12 Antibody [NBP1-89020]

Immunohistochemistry-Paraffin: SLC25A12 Antibody [NBP1-89020] - Staining of human heart muscle shows strong cytoplasmic positivity in cardiomyocytes.
Immunohistochemistry-Paraffin: SLC25A12 Antibody [NBP1-89020]

Immunohistochemistry-Paraffin: SLC25A12 Antibody [NBP1-89020]

Immunohistochemistry-Paraffin: SLC25A12 Antibody [NBP1-89020] - Staining of human prostate shows weak cytoplasmic positivity in smooth muscle cells.

Applications for SLC25A12 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:20 - 1:50

Immunohistochemistry-Paraffin

1:20-1:50

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: SLC25A12

The SLC25A12 gene encodes a calcium-binding mitochondrial carrier protein. The encoded protein localizes to the mitochondria and is involved in the exchange of aspartate for glutamate across the inner mitochondrial membrane. Polymorphisms in the gene encoding thi

Alternate Names

AGC1, araceli hiperlarga, ARALAR, ARALAR1, calcium binding mitochondrial carrier superfamily member Aralar1, calcium-binding mitochondrial carrier protein Aralar1, Mitochondrial aspartate glutamate carrier 1, solute carrier family 25 (mitochondrial carrier, Aralar), member 12, Solute carrier family 25 member 12

Entrez Gene IDs

8604 (Human)

Gene Symbol

SLC25A12

UniProt

O75746 (Human)

Additional SLC25A12 Products

Product Documents for SLC25A12 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for SLC25A12 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for SLC25A12 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review SLC25A12 Antibody - BSA Free and earn rewards!

Have you used SLC25A12 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies