SLC25A23 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-13321

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the amino acids: GRLFEELDSNKDGRVDVHELRQGLARLGGGNPDPGAQQGISSEGDADPDGGLD

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (85%), Rat (83%).

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for SLC25A23 Antibody - BSA Free

Western Blot: SLC25A23 Antibody [NBP2-13321]

Western Blot: SLC25A23 Antibody [NBP2-13321]

Western Blot: SLC25A23 Antibody [NBP2-13321] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunohistochemistry-Paraffin: SLC25A23 Antibody [NBP2-13321]

Immunohistochemistry-Paraffin: SLC25A23 Antibody [NBP2-13321]

Immunohistochemistry-Paraffin: SLC25A23 Antibody [NBP2-13321] - Staining of human lateral ventricle shows moderate cytoplasmic positivity in neuronal cells.
SLC25A23 Antibody - BSA Free Western Blot: SLC25A23 Antibody - BSA Free [NBP2-13321]

Western Blot: SLC25A23 Antibody - BSA Free [NBP2-13321]

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: Human cell line RT-4
Lane 3: Human cell line U-251MG sp

Applications for SLC25A23 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:20 - 1:50

Immunohistochemistry-Paraffin

1:20 - 1:50

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: SLC25A23

Calcium-dependent mitochondrial solute carrier. Mitochondrial solute carriers shuttle metabolites,nucleotides, and cofactors through the mitochondrial inner membrane. May act as a ATP-Mg/Pi exchanger that mediatesthe transport of Mg-ATP in exchange for phosphate, catalyzing the net uptake or efflux of adenine nucleotides into orfrom the mitochondria

Alternate Names

APC2FLJ30339, calcium-binding mitochondrial carrier protein SCaMC-3, MCSC2, MGC2615, Mitochondrial ATP-Mg/Pi carrier protein 2, Mitochondrial Ca(2+)-dependent solute carrier protein 2, mitochondrial Ca2+-dependent solute carrier protein 2, SCAMC3, SCaMC-3, short calcium-binding mitochondrial carrier 3, Small calcium-binding mitochondrial carrier protein 3, solute carrier family 25 (mitochondrial carrier; phosphate carrier), member 23, Solute carrier family 25 member 23

Gene Symbol

SLC25A23

Additional SLC25A23 Products

Product Documents for SLC25A23 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for SLC25A23 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for SLC25A23 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review SLC25A23 Antibody - BSA Free and earn rewards!

Have you used SLC25A23 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...