SLC35C2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-32008

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all SLC35C2 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: KALHSRGDGGPKALKGLGSSPDLELLLRSSQREEGDNEEEEYFVAQ

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (83%), Rat (80%)

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for SLC35C2 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: SLC35C2 Antibody [NBP2-32008]

Immunocytochemistry/ Immunofluorescence: SLC35C2 Antibody [NBP2-32008]

Immunocytochemistry/Immunofluorescence: SLC35C2 Antibody [NBP2-32008] - Staining of human cell line U-2 OS shows localization to the Golgi apparatus.
Immunohistochemistry-Paraffin: SLC35C2 Antibody [NBP2-32008]

Immunohistochemistry-Paraffin: SLC35C2 Antibody [NBP2-32008]

Immunohistochemistry-Paraffin: SLC35C2 Antibody [NBP2-32008] - Staining of human colon shows strong nuclear positivity in glandular cells.

Applications for SLC35C2 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: SLC35C2

Oxygenation levels play an important role in the regulation of cellular invasiveness which occurs during early implantation when the trophoblast cells invade the uterus as well as during tumour progression and metastasis. This gene, which is regulated by oxygen tension, is induced in hypoxic trophoblast cells and is overexpressed in ovarian cancer. Two protein isoforms are encoded by transcript variants of this gene. Transcript Variant: This variant (2) differs in the 5' UTR compared to variant 1. Variants 1 and 2 encode the same isoform (a).

Alternate Names

bA394O2.1, C20orf5, CGI-15, FLJ37039, FLJ46434, MGC20633, MGC32079, MGC39183, ovarian cancer overexpressed 1, Ovarian cancer-overexpressed gene 1 protein, OVCOV1, solute carrier family 35 member C2, solute carrier family 35, member C2

Gene Symbol

SLC35C2

UniProt

Q9NQQ7 (Human)

Additional SLC35C2 Products

Product Documents for SLC35C2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for SLC35C2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for SLC35C2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review SLC35C2 Antibody - BSA Free and earn rewards!

Have you used SLC35C2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies