SLC38A3 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-60103

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Synthetic peptides corresponding to SLC38A3(solute carrier family 38, member 3) The peptide sequence was selected from the N terminal of SLC38A3. Peptide sequence GNQRVEDPARSCMEGKSFLQKSPSKEPHFTDFEGKTSFGMSVFNLSNAIM. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

56 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for SLC38A3 Antibody - BSA Free

Western Blot: SLC38A3 Antibody [NBP1-60103]

Western Blot: SLC38A3 Antibody [NBP1-60103]

Western Blot: SLC38A3 Antibody [NBP1-60103] - HepG2 cell lysate, concentration 0.2-1 ug/ml.
Immunohistochemistry: SLC38A3 Antibody [NBP1-60103]

Immunohistochemistry: SLC38A3 Antibody [NBP1-60103]

Immunohistochemistry: SLC38A3 Antibody [NBP1-60103] - Dilution : 1: 200 Secondary Antibody : Goat anti-rabbit Alexafluor 568 Secondary Antibody Dilution : 1: 200 Color/Signal Descriptions : SLC38A3: Red CtBp: Green DAPI: Blue Gene Name : SLC38A3 Submitted by : Anonymous
Immunohistochemistry: SLC38A3 Antibody [NBP1-60103]

Immunohistochemistry: SLC38A3 Antibody [NBP1-60103]

Immunohistochemistry: SLC38A3 Antibody [NBP1-60103] - :1:200 Secondary Antibody : Goat anti-rabbit Alexafluor 568 Secondary Antibody Dilution :1:200 Color/Signal Descriptions :SLC38A3: Red CtBp: Green DAPI: Blue. submitted by anonymous customer

Applications for SLC38A3 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: SLC38A3

As a sodium-dependent amino acid/proton antiporter, SLC38A3 mediates electrogenic cotransport of glutamine and sodium ions in exchange for protons. It also recognizes histidine, asparagine and alanine. It may mediate amino acid transport in either direction under physiological conditions and play a role in nitrogen metabolism and synaptic transmission.

Alternate Names

G17sodium-coupled neutral amino acid transporter 3, Na(+)-coupled neutral amino acid transporter 3, NAT1, N-system amino acid transporter 1, SN1system N1 Na+ and H+-coupled glutamine transporter, SNAT3, Solute carrier family 38 member 3, solute carrier family 38, member 3, System N amino acid transporter 1

Gene Symbol

SLC38A3

UniProt

Additional SLC38A3 Products

Product Documents for SLC38A3 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for SLC38A3 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for SLC38A3 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review SLC38A3 Antibody - BSA Free and earn rewards!

Have you used SLC38A3 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...