SLC39A5 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-69296

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Synthetic peptides corresponding to SLC39A5(solute carrier family 39 (metal ion transporter), member 5) The peptide sequence was selected from the N terminal of SLC39A5. Peptide sequence MGSPVSHLLAGFCVWVVLGWVGGSVPNLGPAEQEQNHYLAQLFGLYGENG. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

56 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for SLC39A5 Antibody - BSA Free

Western Blot: SLC39A5 Antibody [NBP1-69296]

Western Blot: SLC39A5 Antibody [NBP1-69296]

Western Blot: SLC39A5 Antibody [NBP1-69296] - This Anti-SLC39A5 antibody was used in Western Blot of HepG2 tissue lysate at a concentration of 0.5ug/ml.
Immunohistochemistry: SLC39A5 Antibody [NBP1-69296]

Immunohistochemistry: SLC39A5 Antibody [NBP1-69296]

Immunohistochemistry: SLC39A5 Antibody [NBP1-69296] - Human Liver.

Applications for SLC39A5 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:10-1:500

Immunohistochemistry-Paraffin

1:10-1:500

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: SLC39A5

Zinc is an essential cofactor for hundreds of enzymes. It is involved in protein, nucleic acid, carbohydrate, and lipid metabolism, as well as in the control of gene transcription, growth, development, and differentiation. SLC39A5 belongs to a subfamily of proteins that show structural characteristics of zinc transporters.Zinc is an essential cofactor for hundreds of enzymes. It is involved in protein, nucleic acid, carbohydrate, and lipid metabolism, as well as in the control of gene transcription, growth, development, and differentiation. SLC39A5 belongs to a subfamily of proteins that show structural characteristics of zinc transporters (Taylor and Nicholson, 2003).[supplied by OMIM].

Alternate Names

LZT-Hs7, MGC34778, solute carrier family 39 (metal ion transporter), member 5, Solute carrier family 39 member 5, zinc transporter ZIP5, ZIP5, ZIP-5, Zrt- and Irt-like protein 5

Gene Symbol

SLC39A5

UniProt

Additional SLC39A5 Products

Product Documents for SLC39A5 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for SLC39A5 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for SLC39A5 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review SLC39A5 Antibody - BSA Free and earn rewards!

Have you used SLC39A5 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for SLC39A5 Antibody - BSA Free

Showing  1 - 1 of 1 FAQ Showing All
  • Q:

    I am interested in antibody NBP1-69296, and I see two bands in the WB result in the datasheet at around 56kDa and another band at around 42kDa. I've checked in uniprot, http://www.uniprot.org/uniprot/Q6ZMH5 Uniprot, and found no isoforms of this protein.

    A: From Uniprot, this protein has an expected molecular weight of 56kDa. So I would expect to see this band in samples where the full protein is present. This protein does also have a signal peptide. I would assume that the smaller band (42kDa) is the cleaved protein (without the signal peptide). Depending on the samples, this band may or may not be present. You may need to research the literature to see how to induce this cleavage or what tissues are suppose to express the cleaved protein to be sure.

Showing  1 - 1 of 1 FAQ Showing All
View all FAQs for Antibodies
Loading...