SLC3A1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-68912

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all SLC3A1 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: SPKCLDWWQEGPMYQIYPRSFKDSNKDGNGDLKGIQDKLDYITALNIKTVWITSFYKSSLKDFRYGVEDFREVDPIFGTMEDFEN

Reactivity Notes

Mouse 89%, Rat 89%

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for SLC3A1 Antibody - BSA Free

Western Blot: SLC3A1 Antibody [NBP2-68912]

Western Blot: SLC3A1 Antibody [NBP2-68912]

Western Blot: SLC3A1 Antibody [NBP2-68912] - Analysis in human cell line RT-4, human cell line U-251 MG, human plasma, human liver tissue and human tonsil tissue.
Immunocytochemistry/ Immunofluorescence: SLC3A1 Antibody [NBP2-68912]

Immunocytochemistry/ Immunofluorescence: SLC3A1 Antibody [NBP2-68912]

Immunocytochemistry/Immunofluorescence: SLC3A1 Antibody [NBP2-68912] - Staining of human cell line RPTEC TERT1 shows localization to mitochondria.

Applications for SLC3A1 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Western Blot

0.04-0.4 ug/ml
Application Notes
Recommended conditions: Fixation/Permeabilization: PFA/Triton X-100

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: SLC3A1

SLC3A1 - solute carrier family 3 (cystine, dibasic and neutral amino acid transporters, activator of cystine, dibasic and neutral amino acid transport), member 1

Alternate Names

activator of cystine, dibasic and neutral amino acid transport), member 1, amino acid transporter 1, ATR1SLC3A1 variant C, B(0+)-type amino acid transport protein, CSNU1, D2h, D2HSLC3A1 variant D, dibasic and neutral amino acid transporters), FLJ34681, member 1, NBATneutral and basic amino acid transport protein rBAT, RBATSLC3A1 variant B, SLC3A1 variant E, SLC3A1 variant F, SLC3A1 variant G, solute carrier family 3 (cystine, dibasic and neutral amino acid transporters

Gene Symbol

SLC3A1

Additional SLC3A1 Products

Product Documents for SLC3A1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for SLC3A1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for SLC3A1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review SLC3A1 Antibody - BSA Free and earn rewards!

Have you used SLC3A1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies