SLC44A2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-10576

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
Loading...

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Human SLC44A2 (NP_065161). Peptide sequence IMVWVMIIMVILVLGYGIFHCYMEYSRLRGEAGSDVSLVDLGFQTDFRVY

Clonality

Polyclonal

Host

Rabbit

Theoretical MW

80 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for SLC44A2 Antibody - BSA Free

Western Blot: SLC44A2 Antibody [NBP3-10576]

Western Blot: SLC44A2 Antibody [NBP3-10576]

Western Blot: SLC44A2 Antibody [NBP3-10576] - Host: Rabbit. Target: SLC44A2. Positive control (+): MCF7 (N10). Negative control (-): A549 (N03). Antibody concentration: 1ug/ml
Western Blot: SLC44A2 Antibody [NBP3-10576]

Western Blot: SLC44A2 Antibody [NBP3-10576]

Western Blot: SLC44A2 Antibody [NBP3-10576] - 25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/mL of the antibody was used in this experiment.

Applications for SLC44A2 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

Optimal dilutions of this antibody should be experimentally determined.

Western Blot

Optimal dilutions of this antibody should be experimentally determined.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: SLC44A2

SLC44A2, also known as Choline transporter-like protein 2, is a 80kDa 706 amino acid protein with a short 704 isoform approximately 80kDa and a longer 711 isoform approximately 81kDa. Isoform 1 may function as a choline transporter. Research is currently being conducted on SLC44A2 in relation tocarcinoma, leukemia, colon carcinoma and chronic lymphocytic leukemia.

Alternate Names

CTL2choline transporter-like protein 2, DKFZp666A071, FLJ44586, PP1292, Solute carrier family 44 member 2, solute carrier family 44, member 2

Gene Symbol

SLC44A2

Additional SLC44A2 Products

Product Documents for SLC44A2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for SLC44A2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for SLC44A2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review SLC44A2 Antibody - BSA Free and earn rewards!

Have you used SLC44A2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...