SLC7A8 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-49319

Novus Biologicals
Loading...

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: WQHKPKCFSDFIELLTLVSQKMCVVVYPEVERGSGTEEANED

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for SLC7A8 Antibody - BSA Free

Immunohistochemistry-Paraffin: SLC7A8 Antibody [NBP2-49319]

Immunohistochemistry-Paraffin: SLC7A8 Antibody [NBP2-49319]

Immunohistochemistry-Paraffin: SLC7A8 Antibody [NBP2-49319] - Staining of human parathyroid gland shows high expression.
Immunohistochemistry-Paraffin: SLC7A8 Antibody [NBP2-49319]

Immunohistochemistry-Paraffin: SLC7A8 Antibody [NBP2-49319]

Immunohistochemistry-Paraffin: SLC7A8 Antibody [NBP2-49319] - Staining of human liver shows low expression as expected.
Immunohistochemistry-Paraffin: SLC7A8 Antibody [NBP2-49319]

Immunohistochemistry-Paraffin: SLC7A8 Antibody [NBP2-49319]

Immunohistochemistry-Paraffin: SLC7A8 Antibody [NBP2-49319] - Staining in human parathyroid gland and liver tissues using anti-SLC7A8 antibody. Corresponding SLC7A8 RNA-seq data are presented for the same tissues.

Applications for SLC7A8 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:20 - 1:50

Immunohistochemistry-Paraffin

1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: SLC7A8

Sodium-independent, high-affinity transport of small and large neutral amino acids such as alanine, serine, threonine, cysteine, phenylalanine, tyrosine, leucine, arginine and tryptophan, when associated with SLC3A2/4F2hc. Acts as an amino acid exchanger. Has higher affinity for L-phenylalanine than LAT1 but lower affinity for glutamine and serine. L-alanine is transported at physiological concentrations. Plays a role in basolateral (re)absorption of neutral amino acids. Involved in the uptake of methylmercury (MeHg) when administered as the L-cysteine or D,L-homocysteine complexes, and hence plays a role in metal ion homeostasis and toxicity. Involved in the cellular activity of small molecular weight nitrosothiols, via the stereoselective transport of L-nitrosocysteine (L-CNSO) across the transmembrane. Plays an essential role in the reabsorption of neutral amino acids from the epithelial cells to the bloodstream in the kidney

Alternate Names

hLAT2, integral membrane protein E16H, large neutral amino acids transporter small subunit 2, LAT2L-type amino acid transporter 2, LPI-PC1, solute carrier family 7 (amino acid transporter, L-type), member 8, Solute carrier family 7 member 8, y+ system), member 8

Gene Symbol

SLC7A8

Additional SLC7A8 Products

Product Documents for SLC7A8 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for SLC7A8 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for SLC7A8 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review SLC7A8 Antibody - BSA Free and earn rewards!

Have you used SLC7A8 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...