Smad3 Antibody (1T1Q9)

Novus Biologicals | Catalog # NBP3-15672

Recombinant Monoclonal Antibody
Novus Biologicals
100% Guarantee

Key Product Details

Validated by

Knockout/Knockdown

Species Reactivity

Human, Mouse, Rat

Applications

Knockout Validated, Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunoprecipitation

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 1T1Q9 expressed in HEK293
View all Smad3 Primary Antibodies »

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 100-200 of human Smad3 (NP_005893.1). HHELRAMELCEFAFNMKKDEVCVNPYHYQRVETPVLPPVLVPRHTEIPAEFPPLDDYSHSIPENTNFPAGIEPQSNIPETPPPGYLSEDGETSDHQMNHSM

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Smad3 Antibody (1T1Q9)

Smad3 Antibody (1T1Q9)

Western Blot: Smad3 Antibody (1T1Q9) [Smad3] -

Western Blot: Smad3 Antibody (1T1Q9) [Smad3] - Western blot analysis of various lysates, using Smad3 Rabbit mAb at 1:20000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 30s.
Smad3 Antibody (1T1Q9)

Immunohistochemistry: Smad3 Antibody (1T1Q9) [Smad3] -

Immunohistochemistry: Smad3 Antibody (1T1Q9) [Smad3] - Immunohistochemistry analysis of paraffin-embedded Human tonsil using [KO Validated] Smad3 Rabbit mAb at dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.
Smad3 Antibody (1T1Q9)

Immunohistochemistry: Smad3 Antibody (1T1Q9) [Smad3] -

Immunohistochemistry: Smad3 Antibody (1T1Q9) [Smad3] - Immunohistochemistry analysis of paraffin-embedded Human testis using [KO Validated] Smad3 Rabbit mAb at dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.
Smad3 Antibody (1T1Q9)

Western Blot: Smad3 Antibody (1T1Q9) [Smad3] -

Western Blot: Smad3 Antibody (1T1Q9) [Smad3] - Western blot analysis of lysates from Rat testis, using Smad3 Rabbit mAb at 1:20000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 30s.
Smad3 Antibody (1T1Q9)

Western Blot: Smad3 Antibody (1T1Q9) [Smad3] -

Western Blot: Smad3 Antibody (1T1Q9) [Smad3] - Western blot analysis of lysates from wild type(WT) and Smad3 Rabbit mAb knockout (KO) HCT116(KO) cells, using Smad3 Rabbit mAb at 1:20000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 30s.

Applications for Smad3 Antibody (1T1Q9)

Application
Recommended Usage

Immunohistochemistry

1:50 - 1:200

Immunoprecipitation

1:100 - 1:500

Western Blot

1:2000 - 1:20000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Smad3

The protein encoded by the Smad3 gene belongs to the SMAD, a family of proteins similar to the gene products of the Drosophila gene 'mothers against decapentaplegic' (Mad) and the C. elegans gene Sma. SMAD proteins are signal transducers and transcriptional modulators that mediate multiple signaling pathways. This protein functions as a transcriptional modulator activated by transforming growth factor-beta and is thought to play a role in the regulation of carcinogenesis. (provided by RefSeq)

Long Name

Mothers Against DPP Homolog 3

Alternate Names

DKFZp586N0721, DKFZp686J10186, hMAD-3, hSMAD3, HsT17436, JV15-2MGC60396, MAD homolog 3, mad protein homolog, MAD, mothers against decapentaplegic homolog 3, MAD, mothers against decapentaplegic homolog 3 (Drosophila), mad3, MADH3mad homolog JV15-2, mothers against decapentaplegic homolog 3, Mothers against DPP homolog 3, SMA- and MAD-related protein 3, SMAD 3, SMAD family member 3HSPC193, SMAD, mothers against DPP homolog 3, SMAD, mothers against DPP homolog 3 (Drosophila), Smad3

Gene Symbol

SMAD3

Additional Smad3 Products

Product Documents for Smad3 Antibody (1T1Q9)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Smad3 Antibody (1T1Q9)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Smad3 Antibody (1T1Q9)

There are currently no reviews for this product. Be the first to review Smad3 Antibody (1T1Q9) and earn rewards!

Have you used Smad3 Antibody (1T1Q9)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Smad3 Antibody (1T1Q9)

Showing  1 - 1 of 1 FAQ Showing All

  • Q: I was wondering if you can recommend any primary polyclonal Smad3 antibody (reactivity: human) for gel supershifts?

    A: We do provide a wide range of Smad3 antibodies, but unfortunately none of them have been tested for gel shift assay, so we can't guarantee they will work for an application never tested before.

Showing  1 - 1 of 1 FAQ Showing All
View all FAQs for Antibodies