SMN Antibody (9N9Q6)

Novus Biologicals | Catalog # NBP3-16863

Recombinant Monoclonal Antibody
Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 9N9Q6 expressed in HEK293
Loading...

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 103-200 of human SMN (Q16637). SEDGCIYPATIASIDFKRETCVVVYTGYGNREEQNLSDLLSPICEVANNIEQNAQENENESQVSTDESENSRSPGNKSDNIKPKSAPWNSFLPPPPPM

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for SMN Antibody (9N9Q6)

Western Blot: SMN Antibody (9N9Q6) [NBP3-16863]

Western Blot: SMN Antibody (9N9Q6) [NBP3-16863]

Western Blot: SMN Antibody (9N9Q6) [NBP3-16863] - Western blot analysis of extracts of various cell lines, using SMN antibody (NBP3-16863) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 1s.
Immunohistochemistry-Paraffin: SMN Antibody (9N9Q6) [NBP3-16863]

Immunohistochemistry-Paraffin: SMN Antibody (9N9Q6) [NBP3-16863]

Immunohistochemistry-Paraffin: SMN Antibody (9N9Q6) [NBP3-16863] - Immunohistochemistry of paraffin-embedded human lung cancer using SMN Rabbit mAb (NBP3-16863) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
Immunohistochemistry-Paraffin: SMN Antibody (9N9Q6) [NBP3-16863]

Immunohistochemistry-Paraffin: SMN Antibody (9N9Q6) [NBP3-16863]

Immunohistochemistry-Paraffin: SMN Antibody (9N9Q6) [NBP3-16863] - Immunohistochemistry of paraffin-embedded rat brain using SMN Rabbit mAb (NBP3-16863) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.

Applications for SMN Antibody (9N9Q6)

Application
Recommended Usage

Immunohistochemistry

1:50 - 1:200

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: SMN

SMN (Gemin 1) is the central component of a large oligomeric complex (SMN complex), including Gemins 2-7, that is necessary and sufficient for the in vivo assembly of Sm proteins onto the small nuclear (sn)RNAs that mediate pre-mRNA splicing. The SMN complex is found in the cytoplasm and nucleus. Within the nucleus, this protein localizes to subnuclear bodies called gems which are found near coiled bodies containing high concentrations of small ribonucleoproteins (snRNPs). Spinal muscular atrophy, a motor neuron disorder, results from reduced levels or a mutation in the Gemin 1 protein.

Alternate Names

Gemin-1, Kugelberg-Welander disease), SMNC, survival motor neuron protein, survival of motor neuron 1, telomeric

Gene Symbol

SMN1

Additional SMN Products

Product Documents for SMN Antibody (9N9Q6)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for SMN Antibody (9N9Q6)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for SMN Antibody (9N9Q6)

There are currently no reviews for this product. Be the first to review SMN Antibody (9N9Q6) and earn rewards!

Have you used SMN Antibody (9N9Q6)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for SMN Antibody (9N9Q6)

Showing  1 - 1 of 1 FAQ Showing All
  • Q: Could you recommond the Human specific SMN antibody? It will only recognize human SMN, without cross reaction with mouse smn.

    A: We do not have an SMN antibody that has been validated NOT to work in mouse samples. When an antibody is found to not react with a certain species, we mark the data sheet with a (-) next to the species' name. Unfortunately, the SMN antibodies that do not list mouse have not been tested in mouse, and may react.

Showing  1 - 1 of 1 FAQ Showing All
View all FAQs for Antibodies
Loading...