SMNDC1 Antibody - Azide and BSA Free
Novus Biologicals | Catalog # H00010285-B01P
Loading...
Key Product Details
Species Reactivity
Human, Mouse, Rat
Applications
Western Blot, Immunocytochemistry/ Immunofluorescence
Label
Unconjugated
Antibody Source
Polyclonal Mouse IgG
Format
Azide and BSA Free
Loading...
Product Specifications
Immunogen
SMNDC1 (NP_005862.1, 1 a.a. - 238 a.a.) full-length human protein. MSEDLAKQLASYKAQLQQVEAALSGNGENEDLLKLKKDLQEVIELTKDLLSTQPSETLASSDSFASTQPTHSWKVGDKCMAVWSEDGQCYEAEIEEIDEENGTAAITFAGYGNAEVTPLLNLKPVEEGRKAKEDSGNKPMSKKEMIAQQREYKKKKALKKAQRIKELEQEREDQKVKWQQFNNRAYSKNKKGQVKRSIFASPESVTGKVGVGTCGIADKPMTQYQDTSKYNVRHLMPQ
Specificity
SMNDC1 - survival motor neuron domain containing 1,
Clonality
Polyclonal
Host
Mouse
Isotype
IgG
Scientific Data Images for SMNDC1 Antibody - Azide and BSA Free
Western Blot: SMNDC1 Antibody [H00010285-B01P]
Western Blot: SMNDC1 Antibody [H00010285-B01P] - Analysis of SMNDC1 expression in human placenta.Immunocytochemistry/ Immunofluorescence: SMNDC1 Antibody [H00010285-B01P]
Immunocytochemistry/Immunofluorescence: SMNDC1 Antibody [H00010285-B01P] - Analysis of purified antibody to SMNDC1 on HeLa cell. (antibody concentration 10 ug/ml)Western Blot: SMNDC1 Antibody [H00010285-B01P]
Western Blot: SMNDC1 Antibody [H00010285-B01P] - Analysis of SMNDC1 expression in PC-12.Western Blot: SMNDC1 Antibody [H00010285-B01P]
Western Blot: SMNDC1 Antibody [H00010285-B01P] - Analysis of SMNDC1 expression in Raw 264.7.Western Blot: SMNDC1 Antibody [H00010285-B01P]
Western Blot: SMNDC1 Antibody [H00010285-B01P] - Analysis of SMNDC1 expression in A-431.Western Blot: SMNDC1 Antibody [H00010285-B01P]
Western Blot: SMNDC1 Antibody [H00010285-B01P] - Analysis of SMNDC1 expression in NIH/3T3.Western Blot: SMNDC1 Antibody [H00010285-B01P]
Western Blot: SMNDC1 Antibody [H00010285-B01P] - Analysis of SMNDC1 expression in transfected 293T cell line by SMNDC1 polyclonal antibody. Lane 1: SMNDC1 transfected lysate(26.18 KDa). Lane 2: Non-transfected lysate.Applications for SMNDC1 Antibody - Azide and BSA Free
Application
Recommended Usage
Western Blot
1:500
Application Notes
Antibody reactive against Recombinant Protein with GST tag on ELISA and Western Blot and also on transfected lysate in western blot. GST tag alone is used as a negative control. It is also useful for immunofluoresence.
Formulation, Preparation, and Storage
Purification
Protein A purified
Formulation
PBS (pH 7.4)
Format
Azide and BSA Free
Preservative
No Preservative
Concentration
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Background: SMNDC1
Alternate Names
SMNRSMN-related protein, SPF30splicing factor 30, survival of motor neuron-related, survival motor neuron domain containing 1,30 kDa splicing factor SMNrp, Survival motor neuron domain-containing protein 1, survival of motor neuron-related-splicing factor 30
Entrez Gene IDs
10285 (Human)
Gene Symbol
SMNDC1
UniProt
Additional SMNDC1 Products
Product Documents for SMNDC1 Antibody - Azide and BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for SMNDC1 Antibody - Azide and BSA Free
This product is produced by and distributed for Abnova, a company based in Taiwan.
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Customer Reviews for SMNDC1 Antibody - Azide and BSA Free
There are currently no reviews for this product. Be the first to review SMNDC1 Antibody - Azide and BSA Free and earn rewards!
Have you used SMNDC1 Antibody - Azide and BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- ICC Cell Smear Protocol for Suspension Cells
- ICC Immunocytochemistry Protocol Videos
- ICC for Adherent Cells
- Immunocytochemistry (ICC) Protocol
- Immunocytochemistry Troubleshooting
- Immunofluorescence of Organoids Embedded in Cultrex Basement Membrane Extract
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Fluorescent ICC Staining of Cell Smears - Graphic
- Protocol for the Fluorescent ICC Staining of Cultured Cells on Coverslips - Graphic
- Protocol for the Preparation and Fluorescent ICC Staining of Cells on Coverslips
- Protocol for the Preparation and Fluorescent ICC Staining of Non-adherent Cells
- Protocol for the Preparation and Fluorescent ICC Staining of Stem Cells on Coverslips
- Protocol for the Preparation of a Cell Smear for Non-adherent Cell ICC - Graphic
- R&D Systems Quality Control Western Blot Protocol
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...