Snail Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-80022

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Validated:

Human, Mouse

Cited:

Human, Mouse

Applications

Validated:

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Cited:

Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence, IF/IHC

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Synthetic peptide directed towards the N terminal of human SNAI1. Peptide sequence MPRSFLVRKPSDPNRKPNYSELQDSNPEFTFQQPYDQAHLLAAIPPPEIL. The peptide sequence for this immunogen was taken from within the described region.

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID: 28408805)

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

29 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for Snail Antibody - BSA Free

Western Blot: Snail Antibody [NBP1-80022]

Western Blot: Snail Antibody [NBP1-80022]

Western Blot: Snail Antibody [NBP1-80022] - Host: Mouse. Target Name: SNAI1. Sample Tissue: Mouse Spleen. Antibody Dilution: 1ug/ml
Immunohistochemistry-Paraffin: Snail Antibody [NBP1-80022]

Immunohistochemistry-Paraffin: Snail Antibody [NBP1-80022]

Immunohistochemistry-Paraffin: Snail Antibody [NBP1-80022] - Rabbit Anti-SNAI1 Antibody. Formalin Fixed Paraffin Embedded Tissue: Human Urinary Bladder Tissue. Observed Staining: Cytoplasm. Primary Antibody Concentration: 1:100. Secondary Antibody: Donkey anti-Rabbit-Cy3. Secondary Antibody Concentration: 1:200. Ma
Western Blot: Snail Antibody [NBP1-80022]

Western Blot: Snail Antibody [NBP1-80022]

Western Blot: Snail Antibody [NBP1-80022] - 721_B cell lysate, Antibody Titration: 1ug/ml
Western Blot: Snail Antibody [NBP1-80022]

Western Blot: Snail Antibody [NBP1-80022]

Western Blot: Snail Antibody [NBP1-80022] - Antibody Titration: 1 ug/ml Human 721_B.
Western Blot: Snail Antibody [NBP1-80022]

Western Blot: Snail Antibody [NBP1-80022]

Western Blot: Snail Antibody [NBP1-80022] - Antibody Titration: 1 ug/ml Human A549.
Immunohistochemistry-Paraffin: Snail Antibody [NBP1-80022]

Immunohistochemistry-Paraffin: Snail Antibody [NBP1-80022]

Immunohistochemistry-Paraffin: Snail Antibody [NBP1-80022] - Human kidney Tissue, antibody concentration 4-8ug/ml. Cells with positive label: renal corpuscle cells (indicated with arrows) 400X magnification.

Applications for Snail Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:10-1:500

Immunohistochemistry-Paraffin

1:10-1:500

Western Blot

1.0 ug/ml
Application Notes
Use in ICC/IF reported in secitific publication PMID: 32366407.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Snail

Snail, also called SNAIL1 or SNAI1, is a zinc-finger transcription factor belonging to the Snail superfamily and encoded by the SNAI1 gene (1,2). Snail was first discovered in Drosophila and has homologs in many species including vertebrates and humans (1,2). The Snail family members includes Snail (Snail1), Slug (Snail2), and Smuc (Snail3) (1,2). In humans, Snail is expressed in a number of tissues including placenta, brain, and skeletal muscle, but is most highly expressed by the kidneys (1). Snail functions in repression of E-cadherin transcription which is associated with epithelial-mesenchymal transition (EMT) that is especially prominent during embryonic development (1-5). Along with Snail, other related EMT-inducing transcription factors (EMT-TFs) include the Twist and ZEB protein families (3). Snail is synthesized as a protein of 264 amino acids (aa) with an N-terminal SNAG domain, a serine-rich domain (SRD), nuclear export sequences (NES), and four C-terminal zinc-finger binding domains, with a theoretical molecular weight of 29 kDa (1,3). Snail activity is largely regulated through post-translational modifications such as phosphorylation, ubiquitination, and glycosylation, which impacts Snail's localization and stability, amongst other things (1-3, 5).

In addition to its role in embryonic development, Snail-induced EMT is also associated with cancer metastasis (1-5). Snail is expressed in a variety of cancer lines including breast cancer, cervical carcinoma, and colorectal carcinoma, and typically results in increased migration, invasion, and metastasis (1). Accordingly, Snail expression is also correlated with drug resistance and tumor recurrence (1-5). Chemical inhibitors that target Snail have shown some promise in reducing or eliminating Snail-induced EMT, increasing E-cadherin expression, and increasing tumor regression (1).

1. Kaufhold, S., & Bonavida, B. (2014). Central role of Snail1 in the regulation of EMT and resistance in cancer: a target for therapeutic intervention. Journal of Experimental & Clinical Cancer Research. https://doi.org/10.1186/s13046-014-0062-0

2. Wang, Y., Shi, J., Chai, K., Ying, X., & Zhou, B. P. (2013). The Role of Snail in EMT and Tumorigenesis. Current Cancer Drug Targets. https://doi.org/10.2174/15680096113136660102

3. Kang, E., Seo, J., Yoon, H., & Cho, S. (2021). The Post-Translational Regulation of Epithelial-Mesenchymal Transition-Inducing Transcription Factors in Cancer Metastasis. International Journal of Molecular Sciences. https://doi.org/10.3390/ijms22073591

4. Seo, J., Ha, J., Kang, E., & Cho, S. (2021). The role of epithelial-mesenchymal transition-regulating transcription factors in anti-cancer drug resistance. Archives of Pharmacal Research. https://doi.org/10.1007/s12272-021-01321-x

5. Baulida, J., Diaz, V. M., & Herreros, A. G. (2019). Snail1: A Transcriptional Factor Controlled at Multiple Levels. Journal of Clinical Medicine. https://doi.org/10.3390/jcm8060757

Alternate Names

SLUGH2, SNAH, SNAI1

Gene Symbol

SNAI1

Additional Snail Products

Product Documents for Snail Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Snail Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for Snail Antibody - BSA Free

Customer Reviews for Snail Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Snail Antibody - BSA Free and earn rewards!

Have you used Snail Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Snail Antibody - BSA Free

Showing  1 - 1 of 1 FAQ Showing All
  • Q: There are many kinds of antibodies you supply against SNAIL. Could you give me your recommendation? Which is the best for the IHC-P experiments the species of my samples to be tested is human.

    A: Our SNAIL antibody with catalog # NBP1-19529 has been successfully validated for IHC-P in paraffin-embedded human lung carcinoma tissue and I would highly recommend you to use the same for your samples too. The working dilutions of this antibody for IHC-P ranges from 1:50 - 1:200 and beside IHC, you can use this antibody for Western Blot and Immunofluorescence also.

Showing  1 - 1 of 1 FAQ Showing All
View all FAQs for Antibodies