SNRPA1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-33447

Novus Biologicals
100% Guarantee

Key Product Details

Validated by

Knockout/Knockdown

Species Reactivity

Validated:

Human

Cited:

Human

Predicted:

Mouse (99%), Rat (99%). Backed by our 100% Guarantee.

Applications

Validated:

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence, Knockdown Validated

Cited:

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all SNRPA1 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: VTNKKHYRLYVIYKVPQVRVLDFQKVKLKERQEAEKMFKGKRGAQLAKDIARRSKTFNPGAGLPTDKKKGGPSP

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for SNRPA1 Antibody - BSA Free

Western Blot: SNRPA1 Antibody [NBP2-33447]

Western Blot: SNRPA1 Antibody [NBP2-33447]

Western Blot: SNRPA1 Antibody [NBP2-33447] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunocytochemistry/ Immunofluorescence: SNRPA1 Antibody [NBP2-33447]

Immunocytochemistry/ Immunofluorescence: SNRPA1 Antibody [NBP2-33447]

Immunocytochemistry/Immunofluorescence: SNRPA1 Antibody [NBP2-33447] - Immunofluorescent staining of human cell line U-2 OS shows localization to nuclear speckles.
Immunohistochemistry-Paraffin: SNRPA1 Antibody [NBP2-33447]

Immunohistochemistry-Paraffin: SNRPA1 Antibody [NBP2-33447]

Immunohistochemistry-Paraffin: SNRPA1 Antibody [NBP2-33447] - Staining of human stomach, upper shows strong nuclear positivity in glandular cells.
Knockdown Validated: SNRPA1 Antibody [NBP2-33447]

Western Blot: SNRPA1 Antibody [NBP2-33447]

SNRPA1-Antibody-Knockdown-Validated-NBP2-33447-img0008.jpg
Immunoprecipitation: SNRPA1 Antibody [NBP2-33447]

Immunoprecipitation: SNRPA1 Antibody [NBP2-33447]

Immunoprecipitation: SNRPA1 Antibody [NBP2-33447] - Immunoprecipitation of SNRPA1 using NBP2-33447 or Rabbit IgG isotype control at a 1:100 dilution, followed by pulldown with Protein A magnetic beads. IP image submitted by a verified customer review.
SNRPA1 Antibody

Western Blot: SNRPA1 Antibody [NBP2-33447] -

Western Blot: SNRPA1 Antibody [NBP2-33447] - Recruitment kinetics of SNRPA1 & SF3A3 after laser microirradiation & SNRPA1-dependent recruitment of RAD51 & BRCA1 to laser tracks. (a) Image-based cytometry reveals increased gamma H2AX formation after 72 h SNRPA1 knockdown in U2OS cells. SNRPA1 knockdown effciency is shown in the bar graph. U2OS cells transiently (b) or stably (c) expressing SNRPA1-GFP were microirradiated & protein recruitment followed in real-time. For transcription & splicing inhibition cells were pretreated with DRB (50 μM) or SSA (100 nM) for at least 1 h before damage induction. Representative confocal images & recruitment kinetics are shown. (d) As in (b & c) but in cells stably expressing SF3A3-GFP. (e) Generation of R-loops at laser tracks visualized by HB-GFP recruitment. HB-GFP recruitment kinetics resemble SNRPA1-GFP. (f) Schematic of SNRPA1 deletion constructs. (g) Representative confocal images of recruitment of wild-type & mutated GFP-tagged SNRPA1 after laser microirradiation. (h) Quantification of recruitment, non-recruitment & displacement of GFP-tagged SNRPA1 fusions. Ten cells were analyzed per condition. (i) Confirmation of siRNA-mediated depletion of SNRPA1 after 48 & 72 h knockdown in cells used in (j). (j) Recruitment of RAD51 & BRCA1 in control & SNRPA1-depleted U2OS cells. U2OS cells were transfected with control or SNRPA1 siRNA & 48 or 72 h later microirradiated, fixed after indicated repair times & stained for gamma H2AX, RAD51 & BRCA1. Representative confocal images & percentage of cells displaying RAD51 & BRCA1 recruitment are shown. Scale bar 5 or 10 μM (i). Statistically significant differences were determined using Student's t-test, *P<0.05, **P<0.01. Error bars represent s.e.m. RFU (relative fluorescence units). Image collected & cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/27991914), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
SNRPA1 Antibody

Western Blot: SNRPA1 Antibody [NBP2-33447] -

Western Blot: SNRPA1 Antibody [NBP2-33447] - SNRPA1 knockdown impairs BRCA1 & RAD51 accumulation at endonuclease (FokI) cleaved single DSB sites & radiation-induced DSB sites. (a) Visualization of endonuclease-mediated DSB induced by Shield 1 addition in 2-6-5 reporter cells with mCherry-LacI-FokI fusion protein expression. Cells were transfected with indicated siRNA, & 48 h later 4-OHT & Shield 1 were added for 5 h to induce mCherry-LacI-FokI expression. Cells were fixed & immunostained with indicated antibodies. In SNRPA1-depleted cells, BRCA1 & RAD51 accumulation to endonuclease cleaved single DSB sites were significantly reduced. (b) U2OS cells were transfected with control or SNRPA1 siRNA & after indicated time periods irradiated with 2 Gy. Two hours after irradiation, cells were fixed & immunostained. Quantification of RAD51 (>12 foci), gamma H2AX (>12 foci), BRCA1 (>12 foci) & RPA (>12 foci) positive cells. For each condition, more than 400 cells were analyzed. (c) After indicated time periods of SNRPA1 knockdown, cells were collected & analyzed by western blotting. Forty-eight hours after SNRPA1 depletion, protein expression levels of RAD51 & Chk1 were already reduced. At 24 h after siSNRPA1 transfection, gamma H2AX levels transiently increased & then declined. The error bars represent s.e.m. from three independent experiments (n=3). Statistically significant differences between cells treated with control or splicing factor siRNA were determined using Student's t-test, *P<0.05, **P<0.01. Scale bar is 10 μm. Image collected & cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/27991914), licensed under a CC-BY license. Not internally tested by Novus Biologicals.

Applications for SNRPA1 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Paraffin

1:200 - 1:500

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. SNRPA1 Antibody is validated for IP from a verified customer review.

Reviewed Applications

Read 1 review rated 5 using NBP2-33447 in the following applications:

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: SNRPA1

This protein is associated with sn-RNP U2. It helps the A' protein to bind stem loop IV of U2 snRNA

Alternate Names

Lea1, small nuclear ribonucleoprotein polypeptide A', U2 small nuclear ribonucleoprotein A', U2 small nuclear ribonucleoprotein polypeptide A', U2 snRNP A'

Gene Symbol

SNRPA1

UniProt

P09661 (Human)

Additional SNRPA1 Products

Product Documents for SNRPA1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for SNRPA1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for SNRPA1 Antibody - BSA Free

Customer Reviews for SNRPA1 Antibody - BSA Free (1)

5 out of 5
1 Customer Rating
5 Stars
100%
4 Stars
0%
3 Stars
0%
2 Stars
0%
1 Stars
0%

Have you used SNRPA1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Customer Images

Showing  1 - 1 of 1 review Showing All
Filter By:
Clear Filters X
  • SNRPA1 Antibody
    Name: Anonymous
    Application: Immunoprecipitation
    Sample Tested: human whole cell lysates and immunoprecipitates from human whole cell lysates
    Species: Human
    Verified Customer | Posted 04/22/2021
    Immunoprecipitation of SNRPA1 using NBP2-33447 or Rabbit IgG isotype control at a 1:100 dilution, followed by pulldown with Protein A magnetic beads.
    SNRPA1 Antibody - BSA Free NBP2-33447

There are no reviews that match your criteria.

Showing  1 - 1 of 1 review Showing All

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies