SNRPB Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-35914

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, ELISA

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all SNRPB Primary Antibodies »

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 1-100 of human SNRPB (NP_003082.1).

Sequence:
MTVGKSSKMLQHIDYRMRCILQDGRIFIGTFKAFDKHMNLILCDCDEFRKIKPKNSKQAEREEKRVLGLVLLRGENLVSMTVEGPPPKDTGIARVPLAGA

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

25 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for SNRPB Antibody - BSA Free

SNRPB Antibody

Western Blot: SNRPB Antibody [NBP3-35914] -

Western Blot: SNRPB Antibody [NBP3-35914] - Western blot analysis of various lysates using SNRPB Rabbit pAb at 1:3000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit.
Exposure time: 180s.
SNRPB Antibody

Immunohistochemistry: SNRPB Antibody [NBP3-35914] -

Immunohistochemistry: SNRPB Antibody [NBP3-35914] - Immunohistochemistry analysis of paraffin-embedded Mouse spleen using SNRPB Rabbit pAb at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.
SNRPB Antibody

Immunohistochemistry: SNRPB Antibody [NBP3-35914] -

Immunohistochemistry: SNRPB Antibody [NBP3-35914] - Immunohistochemistry analysis of paraffin-embedded Rat spleen using SNRPB Rabbit pAb at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.
SNRPB Antibody

Immunohistochemistry: SNRPB Antibody [NBP3-35914] -

Immunohistochemistry: SNRPB Antibody [NBP3-35914] - Immunohistochemistry analysis of paraffin-embedded Human colon carcinoma using SNRPB Rabbit pAb at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.

Applications for SNRPB Antibody - BSA Free

Application
Recommended Usage

ELISA

Recommended starting concentration is 1 μg/mL.

Immunohistochemistry-Paraffin

1:50 - 1:200

Western Blot

1:500 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.01% Thimerosal

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: SNRPB

SNRPB is encoded by this gene is one of several nuclear proteins that are found in common among U1, U2, U4/U6, and U5 small ribonucleoprotein particles (snRNPs). These snRNPs are involved in pre-mRNA splicing, and the encoded protein may also play a role in pre-mRNA splicing or snRNP structure. Autoantibodies from patients with systemic lupus erythematosus frequently recognize epitopes on the encoded protein. Two transcript variants encoding different isoforms (B and B') have been found for this gene.

Alternate Names

CODB polypeptide of Sm protein, Sm protein B/B', small nuclear ribonucleoprotein polypeptides B and B', small nuclear ribonucleoprotein polypeptides B and B1, small nuclear ribonucleoprotein-associated proteins B and B', SmB/B', Sm-B/B'sm-B/Sm-B', SmB/SmB', snRNP-Bsmall nuclear ribonucleoprotein polypeptide B, SNRPB1

Gene Symbol

SNRPB

Additional SNRPB Products

Product Documents for SNRPB Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for SNRPB Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for SNRPB Antibody - BSA Free

There are currently no reviews for this product. Be the first to review SNRPB Antibody - BSA Free and earn rewards!

Have you used SNRPB Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies