SNX11 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-85825

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: LFLQSQLSVPEIEACVQGRSTMTVSDAILRYAMSNCGWAQEERQSSSHLAKGDQPKSCCFLPRSGRRSSP

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for SNX11 Antibody - BSA Free

Immunohistochemistry-Paraffin: SNX11 Antibody [NBP1-85825]

Immunohistochemistry-Paraffin: SNX11 Antibody [NBP1-85825]

Immunohistochemistry-Paraffin: SNX11 Antibody [NBP1-85825] - Staining of human placenta shows strong membranous positivity in trophoblastic cells.
Immunohistochemistry-Paraffin: SNX11 Antibody [NBP1-85825]

Immunohistochemistry-Paraffin: SNX11 Antibody [NBP1-85825]

Immunohistochemistry-Paraffin: SNX11 Antibody [NBP1-85825] - Staining of human skeletal muscle shows no positivity in myocytes as expected.
Immunohistochemistry-Paraffin: SNX11 Antibody [NBP1-85825]

Immunohistochemistry-Paraffin: SNX11 Antibody [NBP1-85825]

Immunohistochemistry-Paraffin: SNX11 Antibody [NBP1-85825] - Staining of human lymph node shows strong cytoplasmic positivity in non-germinal center cells.
Immunohistochemistry-Paraffin: SNX11 Antibody [NBP1-85825]

Immunohistochemistry-Paraffin: SNX11 Antibody [NBP1-85825]

Immunohistochemistry-Paraffin: SNX11 Antibody [NBP1-85825] - Staining of human lung shows moderate membranous positivity in pneumocytes.
SNX11 Antibody - BSA Free Western Blot: SNX11 Antibody - BSA Free [NBP1-85825]

Western Blot: SNX11 Antibody - BSA Free [NBP1-85825]

Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells)
Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)
SNX11 Antibody - BSA Free Western Blot: SNX11 Antibody - BSA Free [NBP1-85825]

Western Blot: SNX11 Antibody - BSA Free [NBP1-85825]

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: Human cell line RT-4
Lane 3: Human cell line U-251MG sp

Applications for SNX11 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:500 - 1:1000

Immunohistochemistry-Paraffin

1:500 - 1:1000

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: SNX11

SNX11 encodes a member of the sorting nexin family. Members of this family contain a phox (PX) domain, which is a phosphoinositide binding domain, and are involved in intracellular trafficking. This protein does not contain a coiled coil region, like some family members. This gene encodes a protein of unknown function. This gene results in two transcript variants differing in the 5' UTR, but encoding the same protein. [provided by RefSeq]

Alternate Names

MGC111019, sorting nexin 11, sorting nexin-11

Gene Symbol

SNX11

Additional SNX11 Products

Product Documents for SNX11 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for SNX11 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for SNX11 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review SNX11 Antibody - BSA Free and earn rewards!

Have you used SNX11 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...