SNX2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-89485

Novus Biologicals
Loading...

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: ATEEVSLDSPEREPILSSEPSPAVTPVTPTTLIAPRIESKSMSAPVIFDRSREEIEEEANGDIFDIEIGVSDP

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for SNX2 Antibody - BSA Free

SNX2 Antibody - BSA Free Immunohistochemistry-Paraffin: SNX2 Antibody - BSA Free [NBP1-89485]

Immunohistochemistry-Paraffin: SNX2 Antibody - BSA Free [NBP1-89485]

Analysis in human lymph node and skeletal muscle tissues using NBP1-89485 antibody. Corresponding SNX2 RNA-seq data are presented for the same tissues.
SNX2 Antibody - BSA Free Immunohistochemistry-Paraffin: SNX2 Antibody - BSA Free [NBP1-89485]

Immunohistochemistry-Paraffin: SNX2 Antibody - BSA Free [NBP1-89485]

Staining of human lymph node shows strong membranous positivity in non-germinal center cells.
SNX2 Antibody - BSA Free Immunohistochemistry-Paraffin: SNX2 Antibody - BSA Free [NBP1-89485]

Immunohistochemistry-Paraffin: SNX2 Antibody - BSA Free [NBP1-89485]

Staining of human skeletal muscle shows no positivity in myocytes as expected.
SNX2 Antibody - BSA Free Immunohistochemistry-Paraffin: SNX2 Antibody - BSA Free [NBP1-89485]

Immunohistochemistry-Paraffin: SNX2 Antibody - BSA Free [NBP1-89485]

Staining of human Fallopian tube shows moderate cytoplasmic positivity in glandular cells.
SNX2 Antibody - BSA Free Immunohistochemistry-Paraffin: SNX2 Antibody - BSA Free [NBP1-89485]

Immunohistochemistry-Paraffin: SNX2 Antibody - BSA Free [NBP1-89485]

Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.
SNX2 Antibody - BSA Free Western Blot: SNX2 Antibody - BSA Free [NBP1-89485]

Western Blot: SNX2 Antibody - BSA Free [NBP1-89485]

Analysis in human cell line BEWO.
Western Blot: SNX2 Antibody [NBP1-89485]

Western Blot: SNX2 Antibody [NBP1-89485]

Western Blot: SNX2 Antibody [NBP1-89485] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).

Applications for SNX2 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:500 - 1:1000

Immunohistochemistry-Paraffin

1:500 - 1:1000

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: SNX2

SNX2 (Sorting nexin 2) is a member of the sorting nexin family. Members of this family contain a phox (PX) domain, which is a phosphoinositide binding domain, and are involved in intracellular trafficking. SNX2 is a component of the retromer complex, a complex required to retrieve lysosomal enzyme receptors (IGF2R and M6PR) from endosomes to the trans-Golgi network. It may form oligomeric complexes with family members.

Alternate Names

MGC5204, sorting nexin 2, sorting nexin-2, Transformation-related gene 9 protein, TRG-9

Gene Symbol

SNX2

Additional SNX2 Products

Product Documents for SNX2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for SNX2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for SNX2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review SNX2 Antibody - BSA Free and earn rewards!

Have you used SNX2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...