SOCS-3 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-57204

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Validated:

Human

Predicted:

Mouse (93%), Rat (91%). Backed by our 100% Guarantee.

Applications

Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: FPSPPTEPSSEVPEQPSAQPLPGSPPRRAYYIYSGGEKIPLVLSRPLSSNVATLQHLCRKTVNGHLDSYEKVTQLPGPIREFLDQYDAPL

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for SOCS-3 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: SOCS-3 Antibody [NBP2-57204]

Immunocytochemistry/ Immunofluorescence: SOCS-3 Antibody [NBP2-57204]

Immunocytochemistry/Immunofluorescence: SOCS-3 Antibody [NBP2-57204] - Staining of human cell line U-2 OS shows localization to cytosol. Antibody staining is shown in green.

Applications for SOCS-3 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml
Application Notes
ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: SOCS-3

Accumulating evidence has demonstrated that cytokine receptor signaling is negatively regulated by a family of Src homology 2 domain-containing adaptor molecules termed SOCS (Suppressor of Cytokine Signaling) (1-3). To date, there are eight members of SOCS family that have been recognized, they are SOCS-1, 2, 3, 4, 5, 6, 7 and CIS. Structurally, the SOCS proteins are composed of an N-terminal region of variable length and amino acid composition, a central SH2 domain, and a previously unrecognized C-terminal motif that has been called the SOCS box (4). The SOCS proteins appear to form part of a classical negative feed back loop that regulates cytokine signal transduction via a STAT-induced transcriptional mechanism (5). Transcription of each of the SOCS genes occurs rapidly in vitro and in vivo in response to cytokines, and once produced, the various members of the SOCS family appear to inhibit signaling in different ways. SOCS 3 is an important regulator of fetal liver hematopoiesis. It is also involved in a broad spectrum of cytokines, e.g. IL-2, IL-3, IL-4, IL-6, Epo, Prolactin, and GH (6-8).

Long Name

Suppressor Of Cytokine Signaling 3

Alternate Names

ATOD4, CIS3, Cish3, SOCS3, SSI-3

Gene Symbol

SOCS3

Additional SOCS-3 Products

Product Documents for SOCS-3 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for SOCS-3 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for SOCS-3 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review SOCS-3 Antibody - BSA Free and earn rewards!

Have you used SOCS-3 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...