Sodium Potassium ATPase Alpha 3 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-37955

Novus Biologicals
Loading...

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Validated:

Human, Rat

Cited:

Rat

Predicted:

Mouse (100%). Backed by our 100% Guarantee.

Applications

Validated:

Immunohistochemistry, Immunohistochemistry-Paraffin

Cited:

IF/IHC

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: EVAMTEHKMSVEEVCRKYNTDCVQGLTHSKAQE

Reactivity Notes

Rat reactivity reported in scientific literature (PMID:33154197).

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Sodium Potassium ATPase Alpha 3 Antibody - BSA Free

Immunohistochemistry-Paraffin: Sodium Potassium ATPase Alpha 3 Antibody [NBP2-37955]

Immunohistochemistry-Paraffin: Sodium Potassium ATPase Alpha 3 Antibody [NBP2-37955]

Immunohistochemistry-Paraffin: Sodium Potassium ATPase Alpha 3 Antibody [NBP2-37955] - Analysis in human cerebral cortex and endometrium tissues. Corresponding ATP1A3 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: Sodium Potassium ATPase Alpha 3 Antibody [NBP2-37955]

Immunohistochemistry-Paraffin: Sodium Potassium ATPase Alpha 3 Antibody [NBP2-37955]

Immunohistochemistry-Paraffin: Sodium Potassium ATPase Alpha 3 Antibody [NBP2-37955] - Staining of human endometrium shows no positivity in glandular cells as expected.
Immunohistochemistry-Paraffin: Sodium Potassium ATPase Alpha 3 Antibody [NBP2-37955]

Immunohistochemistry-Paraffin: Sodium Potassium ATPase Alpha 3 Antibody [NBP2-37955]

Immunohistochemistry-Paraffin: Sodium Potassium ATPase Alpha 3 Antibody [NBP2-37955] - Staining of human cerebellum shows strong membranous positivity in Purkinje cells.
Immunohistochemistry-Paraffin: Sodium Potassium ATPase Alpha 3 Antibody [NBP2-37955]

Immunohistochemistry-Paraffin: Sodium Potassium ATPase Alpha 3 Antibody [NBP2-37955]

Immunohistochemistry-Paraffin: Sodium Potassium ATPase Alpha 3 Antibody [NBP2-37955] - Staining of human cerebral cortex shows strong positivity in neuropil.
Immunohistochemistry-Paraffin: Sodium Potassium ATPase Alpha 3 Antibody [NBP2-37955]

Immunohistochemistry-Paraffin: Sodium Potassium ATPase Alpha 3 Antibody [NBP2-37955]

Immunohistochemistry-Paraffin: Sodium Potassium ATPase Alpha 3 Antibody [NBP2-37955] - Staining of human prostate shows no positivity in glandular cells as expected.

Applications for Sodium Potassium ATPase Alpha 3 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:1000 - 1:2500

Immunohistochemistry-Paraffin

1:1000 - 1:2500
Application Notes
IHC-P, Retrieval method: HIER pH6.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Sodium Potassium ATPase Alpha 3

The sodium/potassium ATPase is an integral membrane enzyme found in all cells of higher organisms and is responsible for the ATP-dependent transport of sodium and potassium across the cell membrane. This membrane-bound enzyme is related to a number of other ATPases including sarcoplasmic and endoplasmic reticulum calcium ATPase (SERCA) and plasma membrane calcium ATPase (PMCA). The sodium/potassium ATPase consists of a large, multipass, transmembrane catalytic subunit, termed the alpha subunit, and an associated smaller glycoprotein, termed the beta subunit. Studies indicate that there are three isoforms of the alpha subunit (alpha 1, alpha 2, alpha 3) and two isoforms of the beta subunit (beta 1 and beta 2) encoded by two multigene families. The different isoforms of the sodium/potassium ATPase exhibit tissue-specific and developmental patterns of expression. The alpha 1 and beta mRNAs are present in all cell types examined, whereas the alpha 2 and alpha 3 mRNAs exhibit a more restricted pattern of cell-specific expression. The alpha-3 subunit has been found in neuronal and to skeletal and cardiac muscle, lung and stomach tissues.

Long Name

Sodium/potassium-transporting ATPase subunit alpha-3

Alternate Names

ATP1A3

Gene Symbol

ATP1A3

UniProt

Additional Sodium Potassium ATPase Alpha 3 Products

Product Documents for Sodium Potassium ATPase Alpha 3 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Sodium Potassium ATPase Alpha 3 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for Sodium Potassium ATPase Alpha 3 Antibody - BSA Free

Customer Reviews for Sodium Potassium ATPase Alpha 3 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Sodium Potassium ATPase Alpha 3 Antibody - BSA Free and earn rewards!

Have you used Sodium Potassium ATPase Alpha 3 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...