Somatostatin R1/SSTR1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-88331

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
Loading...

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of human Somatostatin R1/SSTR1. Peptide sequence: RMVALKAGWQQRKRSERKITLMVMMVVMVFVICWMPFYVVQLVNVFAEQD The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for Somatostatin R1/SSTR1 Antibody - BSA Free

Western Blot: Somatostatin R1/SSTR1 Antibody [NBP2-88331]

Western Blot: Somatostatin R1/SSTR1 Antibody [NBP2-88331]

Western Blot: Somatostatin R1/SSTR1 Antibody [NBP2-88331] - WB Suggested Anti-SSTR1 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:1562500. Positive Control: THP-1 cell lysate
Immunohistochemistry: Somatostatin R1/SSTR1 Antibody [NBP2-88331]

Immunohistochemistry: Somatostatin R1/SSTR1 Antibody [NBP2-88331]

Immunohistochemistry: Somatostatin R1/SSTR1 Antibody [NBP2-88331] - Immunohistochemistry with Pancreas tissue at an antibody concentration of 5ug/ml using anti-SSTR1 antibody

Applications for Somatostatin R1/SSTR1 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Somatostatin R1/SSTR1

Somatostatin acts to regulate numerous physiological processes by binding to and activating specific receptors in target tissues. Activation of these receptors by somatostatin--which is secreted by nerve and endocrine cells--regulates the secretion of insulin, glucagon and growth hormone, neuronal excitability in both the brain and the peripheral nervous system, and cell growth. Somatostatin receptors have been implicated in numerous diseases ranging from Alzheimer's to cancers of the gastrointestinal tract, breast, prostate, and pituitary.

Long Name

Somatostatin Receptor Type 1

Alternate Names

SomatostatinR1, SRIF-2, SS1R, SSTR1

Gene Symbol

SSTR1

Additional Somatostatin R1/SSTR1 Products

Product Documents for Somatostatin R1/SSTR1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Somatostatin R1/SSTR1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Somatostatin R1/SSTR1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Somatostatin R1/SSTR1 Antibody - BSA Free and earn rewards!

Have you used Somatostatin R1/SSTR1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...