Sorting Nexin 32 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-93723

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 218-285 of human Sorting Nexin 32 (NP_689973.2). HTRIRDACLRADRVMRAHKCLADDYIPISAALSSLGTQEVNQLRTSFLKLAELFERLRKLEGRVASDE

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Sorting Nexin 32 Antibody - BSA Free

Sorting Nexin 32 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: Sorting Nexin 32 Antibody - BSA Free [NBP2-93723] -

Immunocytochemistry/ Immunofluorescence: Sorting Nexin 32 Antibody - BSA Free [NBP2-93723] - Immunofluorescence analysis of U2OS cells using Sorting Nexin 32 Rabbit pAb (A8006) at dilution of 1:300 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
Sorting Nexin 32 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: Sorting Nexin 32 Antibody - BSA Free [NBP2-93723] -

Immunocytochemistry/ Immunofluorescence: Sorting Nexin 32 Antibody - BSA Free [NBP2-93723] - Immunofluorescence analysis of HeLa cells using Sorting Nexin 32 Rabbit pAb (A8006) at dilution of 1:300 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
Sorting Nexin 32 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: Sorting Nexin 32 Antibody - BSA Free [NBP2-93723] -

Immunocytochemistry/ Immunofluorescence: Sorting Nexin 32 Antibody - BSA Free [NBP2-93723] - Immunofluorescence analysis of PC-12 cells using Sorting Nexin 32 Rabbit pAb (A8006) at dilution of 1:300 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
Sorting Nexin 32 Antibody - BSA Free

Western Blot: Sorting Nexin 32 Antibody - BSA Free [NBP2-93723] -

Western Blot: Sorting Nexin 32 Antibody - BSA Free [NBP2-93723] - Western blot analysis of lysates from Mouse brain using Sorting Nexin 32 Rabbit pAb(A8006) at 1:3000 dilution.
Secondary antibody:HRP Goat Anti-Rabbit IgG (H+L)(AS014) at 1:10000 dilution.
Lysates/proteins: 25 μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection:ECL Basic Kit (RM00020).
Exposuretime:180s.

Applications for Sorting Nexin 32 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50-1:200

Western Blot

1:500-1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Sorting Nexin 32

Sorting Nexin 32 may be involved in several stages of intracellular trafficking

Alternate Names

DKFZp761P1320, FLJ30934, MGC42112, MGC57276, SNX6B, sorting nexin 32, sorting nexin 6B, sorting nexin-32, Sorting nexin-6B

Gene Symbol

SNX32

Additional Sorting Nexin 32 Products

Product Documents for Sorting Nexin 32 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Sorting Nexin 32 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Sorting Nexin 32 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Sorting Nexin 32 Antibody - BSA Free and earn rewards!

Have you used Sorting Nexin 32 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...