Recombinant Human SOS2 GST (N-Term) Protein

Name: Recombinant Human SOS2 GST (N-Term) Protein
Brand: Novus Biologicals
SKU: H00006655-Q01
Price: 749 USD
Availability: InStock

Novus Biologicals | Catalog # H00006655-Q01

Submit a review

Product Documents

100% Guarantee

Product Specifications
Scientific Data
Preparation & Storage
Background
Product Documents
Specific Notices
Research Areas

Key Product Details

Source

Wheat germ

Tag

GST (N-Term)

Applications

Western Blot, ELISA, Affinity Purification, Microarray

View all SOS2 Proteins and Enzymes »

Product Specifications

Description

A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 312-420 of Human SOS2

Source: Wheat Germ (in vitro)

Amino Acid Sequence: LMARPAVALHFQSIADGFKEAVRYVLPRLMLVPVYHCWHYFELLKQLKACSEEQEDRECLNQAITALMNHQGSMDRIYKQYSPRRRPGDPVCPFYSHQLRSKHLAIKKM

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

37.73 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Activity

This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.

Protein / Peptide Type

Recombinant Protein

Scientific Data Images for Recombinant Human SOS2 GST (N-Term) Protein

12.5% SDS-PAGE Stained with Coomassie Blue.

Formulation, Preparation, and Storage

H00006655-Q01

Preparation Method	in vitro wheat germ expression system
Formulation	50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative	No Preservative
Concentration	Please see the vial label for concentration. If unlisted please contact technical services.
Shipping	The product is shipped with dry ice or equivalent. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage	Store at -80C. Avoid freeze-thaw cycles.

Background: SOS2

SOS2 - son of sevenless homolog 2 (Drosophila)

Long Name

Son of Sevenless Homolog 2

Alternate Names

FLJ25596, guanine nucleotide exchange factor, guanine nucleotide releasing factor, son of sevenless (Drosophilia) homolog 2, son of sevenless homolog 2, son of sevenless homolog 2 (Drosophila), SOS-2

Gene Symbol

SOS2

Additional SOS2 Products

Product Documents for Recombinant Human SOS2 GST (N-Term) Protein

Download Product Datasheets

Download SDS

Product Specific Notices for Recombinant Human SOS2 GST (N-Term) Protein

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.