SPINT4 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-62613

Novus Biologicals
Loading...

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: KICGDLKDPCKLDMNFGSCYEVHFRYFYNRTSKRCETFVFSGCNGNLNNFKLK

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for SPINT4 Antibody - BSA Free

Immunohistochemistry-Paraffin: SPINT4 Antibody [NBP2-62613]

Immunohistochemistry-Paraffin: SPINT4 Antibody [NBP2-62613]

Immunohistochemistry-Paraffin: SPINT4 Antibody [NBP2-62613] - Immunohistochemistry analysis in human epididymis and endometrium tissues using Anti-SPINT4 antibody. Corresponding SPINT4 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: SPINT4 Antibody [NBP2-62613]

Immunohistochemistry-Paraffin: SPINT4 Antibody [NBP2-62613]

Immunohistochemistry-Paraffin: SPINT4 Antibody [NBP2-62613] - Staining of human epididymis shows high expression.
Immunohistochemistry-Paraffin: SPINT4 Antibody [NBP2-62613]

Immunohistochemistry-Paraffin: SPINT4 Antibody [NBP2-62613]

Immunohistochemistry-Paraffin: SPINT4 Antibody [NBP2-62613] - Staining of human endometrium shows low expression as expected.

Applications for SPINT4 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:20 - 1:50

Immunohistochemistry-Paraffin

1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Reviewed Applications

Read 1 review rated 1 using NBP2-62613 in the following applications:

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: SPINT4

Alternate Names

C20orf137, Chromosome 20 Open Reading Frame 137, DJ601O1.1, Kunitz-Type Protease Inhibitor 4, Serine Peptidase Inhibitor, Kunitz Type 4, Serine Protease Inhibitor, Kunitz Type 4, SPINT3

Gene Symbol

SPINT4

Additional SPINT4 Products

Product Documents for SPINT4 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for SPINT4 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for SPINT4 Antibody - BSA Free (1)

1 out of 5
1 Customer Rating
5 Stars
0%
4 Stars
0%
3 Stars
0%
2 Stars
0%
1 Stars
100%

Have you used SPINT4 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Customer Images


Showing  1 - 1 of 1 review Showing All
Filter By:
  • SPINT4 Antibody
    Name: Charlotte Dietzel
    Application: Immunocytochemistry
    Sample Tested: plasmid transfected HEK293T cells
    Species: Human
    Verified Customer | Posted 05/10/2023
    40x Image of SPINT4-HA 293T cells showing the non-specific binding and high background noise of NovusBio’s SPINT4 Antibody.
    Overview/Application Description: The specificity and signal/noise ratio of the anti-SPINT4 antibody was tested in immunofluorescence staining analyses of Human HEK293T cells expressing the SPINT4-HA protein. Signal seems to be non-specific (based on the degree of overlap of the SPINT4 and HA signal) with high background (based on the presence of signal in untransfected cells). Procedural Details: HEK293T cells were transfected with an expression plasmid encoding the SPINT4 protein fused to a C-terminal HA epitope (SPINT4-HA). Cells were fixed in 1.5% paraformaldehyde at room temperature, permeabilized with 0.5% Triton-X on ice, blocked using 10% fetal bovine serum in PBS and incubated with rabbit anti-SPINT4 antibodies (1:200 dilution) and with mouse anti-HA antibodies (1:200 dilution) for one hour at room temperature. Samples were washed with blocking buffer and incubated with Alexa Fluor 594-conjugated goat anti-rabbit antibodies (1:200 dilution) and with Alexa Fluor 488-conjugated goat anti-mouse antibodies (1:200 dilution) for one hour at room temperature, prior to washing in PBS and highlighting of nuclear DNA using Hoechst33342 for three minutes. Untransfected cells processed in the same way were used as controls. Coverslips were then mounted, and signal was visualized using a fluorescence microscope.
    SPINT4 Antibody - BSA Free NBP2-62613

There are no reviews that match your criteria.

Showing  1 - 1 of 1 review Showing All

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...