SPRR3 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-35206

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 1-70 of human SPRR3 (NP_005407.1).

Sequence:
MSSYQQKQTFTPPPQLQQQQVKQPSQPPPQEIFVPTTKEPCHSKVPQPGNTKIPEPGCTKVPEPGCTKVP

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

17 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for SPRR3 Antibody - BSA Free

SPRR3 Antibody

Immunocytochemistry/ Immunofluorescence: SPRR3 Antibody [NBP3-35206] -

Immunocytochemistry/ Immunofluorescence: SPRR3 Antibody [NBP3-35206] - Immunofluorescence analysis of C6 cells using SPRR3 Rabbit pAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
SPRR3 Antibody

Western Blot: SPRR3 Antibody [NBP3-35206] -

Western Blot: SPRR3 Antibody [NBP3-35206] - Western blot analysis of various lysates using SPRR3 Rabbit pAb at 1:3000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 90s.
SPRR3 Antibody

Immunocytochemistry/ Immunofluorescence: SPRR3 Antibody [NBP3-35206] -

Immunocytochemistry/ Immunofluorescence: SPRR3 Antibody [NBP3-35206] - Immunofluorescence analysis of U2OS cells using SPRR3 Rabbit pAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
SPRR3 Antibody

Immunocytochemistry/ Immunofluorescence: SPRR3 Antibody [NBP3-35206] -

Immunocytochemistry/ Immunofluorescence: SPRR3 Antibody [NBP3-35206] - Immunofluorescence analysis of L929 cells using SPRR3 Rabbit pAb at dilution of 1:100. Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

Applications for SPRR3 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.01% Thimerosal

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: SPRR3

SPRR3, also known as Small proline-rich protein 3, consists of a 169 amino acid isoform that is 18 kDa, and is involved in the surrounding and protection of keratinocytes. Disease research on the protein is currently being conducted with ichthyosis vulgaris, psoriasis, eosinophilic esophagitis, verrucous carcinoma, periodontitis, esophageal cancer, eczema, tonsillitis, and skin disease. SPRR3 is linked to several biological processes, including epidermis development, wound healing, and keratinocyte differentiation, in which it interacts with other proteins, such as IVL, EVPL, NFKBIA, and LOR.

Alternate Names

22 kDa pancornulin, Cornifin beta, Esophagin, small proline-rich protein 3, SPRC

Gene Symbol

SPRR3

Additional SPRR3 Products

Product Documents for SPRR3 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for SPRR3 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for SPRR3 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review SPRR3 Antibody - BSA Free and earn rewards!

Have you used SPRR3 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...