SSBIP1/SOSS-C Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-81682

Novus Biologicals
100% Guarantee

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Validated:

Human

Predicted:

Mouse (96%), Rat (94%). Backed by our 100% Guarantee.

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all SSBIP1/SOSS-C Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: KEKRKLLMQNQSSTNHPGASIALSRPSLNKDFRDHAEQQHIAAQQKAALQHAHAHSSGYFITQDSAFGNL

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for SSBIP1/SOSS-C Antibody - BSA Free

Immunohistochemistry-Paraffin: SSBIP1/SOSS-C Antibody [NBP1-81682]

Immunohistochemistry-Paraffin: SSBIP1/SOSS-C Antibody [NBP1-81682]

Immunohistochemistry-Paraffin: SSBIP1/SOSS-C Antibody [NBP1-81682] - Staining in human thyroid gland and skeletal muscle tissues.. Corresponding INIP RNA-seq data are presented for the same tissues.
Western Blot: SSBIP1/SOSS-C Antibody [NBP1-81682]

Western Blot: SSBIP1/SOSS-C Antibody [NBP1-81682]

Western Blot: SSBIP1/SOSS-C Antibody [NBP1-81682] - Analysis in control (vector only transfected HEK293T lysate) and INIP over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunocytochemistry/ Immunofluorescence: SSBIP1/SOSS-C Antibody [NBP1-81682]

Immunocytochemistry/ Immunofluorescence: SSBIP1/SOSS-C Antibody [NBP1-81682]

Immunocytochemistry/Immunofluorescence: SSBIP1/SOSS-C Antibody [NBP1-81682] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: SSBIP1/SOSS-C Antibody [NBP1-81682]

Immunohistochemistry-Paraffin: SSBIP1/SOSS-C Antibody [NBP1-81682]

Immunohistochemistry-Paraffin: SSBIP1/SOSS-C Antibody [NBP1-81682] - Staining of human skeletal muscle shows no positivity in myocytes as expected.
Immunohistochemistry-Paraffin: SSBIP1/SOSS-C Antibody [NBP1-81682]

Immunohistochemistry-Paraffin: SSBIP1/SOSS-C Antibody [NBP1-81682]

Immunohistochemistry-Paraffin: SSBIP1/SOSS-C Antibody [NBP1-81682] - Staining of human skin shows strong nuclear positivity in keratinocytes.
Immunohistochemistry-Paraffin: SSBIP1/SOSS-C Antibody [NBP1-81682]

Immunohistochemistry-Paraffin: SSBIP1/SOSS-C Antibody [NBP1-81682]

Immunohistochemistry-Paraffin: SSBIP1/SOSS-C Antibody [NBP1-81682] - Staining of human fallopian tube shows strong nuclear positivity in glandular cells.
Immunohistochemistry-Paraffin: SSBIP1/SOSS-C Antibody [NBP1-81682]

Immunohistochemistry-Paraffin: SSBIP1/SOSS-C Antibody [NBP1-81682]

Immunohistochemistry-Paraffin: SSBIP1/SOSS-C Antibody [NBP1-81682] - Staining of human cerebral cortex shows strong nuclear positivity in neurons.
Immunohistochemistry-Paraffin: SSBIP1/SOSS-C Antibody [NBP1-81682]

Immunohistochemistry-Paraffin: SSBIP1/SOSS-C Antibody [NBP1-81682]

Immunohistochemistry-Paraffin: SSBIP1/SOSS-C Antibody [NBP1-81682] - Staining of human thyroid gland shows nuclear positivity in glandular cells.

Applications for SSBIP1/SOSS-C Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:20 - 1:50

Immunohistochemistry-Paraffin

1:20 - 1:50

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF,Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: SSBIP1/SOSS-C

C9orf80 is a component of the SOSS complex, a multiprotein complex that functions downstream of the MRN complex to promoteDNA repair and G2/M checkpoint. The SOSS complex associates with single-stranded DNA at DNA lesions and influencesdiverse endpoints in the cellula

Alternate Names

chromosome 9 open reading frame 80, HSPC043, hSSB-interacting protein 1, hSSBIP1, minute INTS3/hSSB-associated element, MISE, Sensor of single-strand DNA complex subunit C, Sensor of ssDNA subunit C, Single-stranded DNA-binding protein-interacting protein 1, SOSS complex subunit C, SOSSC, SOSS-C, SSB-interacting protein 1, SSBIP1

Gene Symbol

INIP

Additional SSBIP1/SOSS-C Products

Product Documents for SSBIP1/SOSS-C Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for SSBIP1/SOSS-C Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for SSBIP1/SOSS-C Antibody - BSA Free

There are currently no reviews for this product. Be the first to review SSBIP1/SOSS-C Antibody - BSA Free and earn rewards!

Have you used SSBIP1/SOSS-C Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies