ST3GAL5 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-62444

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Synthetic peptides corresponding to ST3GAL5(ST3 beta-galactoside alpha-2,3-sialyltransferase 5) The peptide sequence was selected from the N terminal of ST3GAL5 (NP_003887). Peptide sequence DSEAESKYDPPFGFRKFSSKVQTLLELLPEHDLPEHLKAKTCRRCVVIGS. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

48 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for ST3GAL5 Antibody - BSA Free

Western Blot: ST3GAL5 Antibody [NBP1-62444]

Western Blot: ST3GAL5 Antibody [NBP1-62444]

Western Blot: ST3GAL5 Antibody [NBP1-62444] - Titration: 1.25ug/ml Positive Control: Jurkat cell lysate.
Immunohistochemistry-Paraffin: ST3GAL5 Antibody [NBP1-62444]

Immunohistochemistry-Paraffin: ST3GAL5 Antibody [NBP1-62444]

Immunohistochemistry-Paraffin: ST3GAL5 Antibody [NBP1-62444] - Human kidney Tissue, antibody concentration 4-8ug/ml. Cells with positive label: renal corpuscle cells (indicated with arrows) 400X magnification.

Applications for ST3GAL5 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:10-1:500

Immunohistochemistry-Paraffin

4-8 ug/ml

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Protein A purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

1 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: ST3GAL5/GM3 Synthase

Ganglioside GM3 is known to participate in the induction of cell differentiation, modulation of cell proliferation, maintenance of fibroblast morphology, signal transduction, and integrin-mediated cell adhesion. ST3GAL5 is a type II membrane protein which catalyzes the formation of GM3 using lactosylceramide as the substrate. It is a member of glycosyltransferase family 29 and may be localized to the Golgi apparatus. Mutation in its gene has been associated with Amish infantile epilepsy syndrome.Ganglioside GM3 is known to participate in the induction of cell differentiation, modulation of cell proliferation, maintenance of fibroblast morphology, signal transduction, and integrin-mediated cell adhesion. The protein encoded by this gene is a type II membrane protein which catalyzes the formation of GM3 using lactosylceramide as the substrate. The encoded protein is a member of glycosyltransferase family 29 and may be localized to the Golgi apparatus.

Long Name

ST3 beta-Galactoside alpha-2,3-Sialyltransferase 5

Alternate Names

3S-T, Ganglioside GM3 Synthase, SATI, Siat9, ST3GALV

Entrez Gene IDs

8869 (Human)

Gene Symbol

ST3GAL5

UniProt

Additional ST3GAL5/GM3 Synthase Products

Product Documents for ST3GAL5 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for ST3GAL5 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Customer Reviews for ST3GAL5 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review ST3GAL5 Antibody - BSA Free and earn rewards!

Have you used ST3GAL5 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...