STIM2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-35783

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 60-180 of human STIM2 (NP_001162588).

Sequence:
CFTEEDRFSLEALQTIHKQMDDDKDGGIEVEESDEFIREDMKYKDATNKHSHLHREDKHITIEDLWKRWKTSEVHNWTLEDTLQWLIEFVELPQYEKNFRDNNVKGTTLPRIAVHEPSFMI

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

84 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for STIM2 Antibody - BSA Free

STIM2 Antibody

Immunohistochemistry: STIM2 Antibody [NBP3-35783] -

Immunohistochemistry: STIM2 Antibody [NBP3-35783] - Immunohistochemistry analysis of paraffin-embedded Mouse brain using STIM2 Rabbit pAb at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.
STIM2 Antibody

Western Blot: STIM2 Antibody [NBP3-35783] -

Western Blot: STIM2 Antibody [NBP3-35783] - Western blot analysis of lysates from 293T cells, using STIM2 Rabbit pAb at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 30s.
STIM2 Antibody

Immunocytochemistry/ Immunofluorescence: STIM2 Antibody [NBP3-35783] -

Immunocytochemistry/ Immunofluorescence: STIM2 Antibody [NBP3-35783] - Immunofluorescence analysis of U-2 OS cells using STIM2 Rabbit pAb at dilution of 1:100. Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
STIM2 Antibody

Immunohistochemistry: STIM2 Antibody [NBP3-35783] -

Immunohistochemistry: STIM2 Antibody [NBP3-35783] - Immunohistochemistry analysis of paraffin-embedded Rat brain using STIM2 Rabbit pAb at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.
STIM2 Antibody

Immunocytochemistry/ Immunofluorescence: STIM2 Antibody [NBP3-35783] -

Immunocytochemistry/ Immunofluorescence: STIM2 Antibody [NBP3-35783] - Immunofluorescence analysis of L929 cells using STIM2 Rabbit pAb at dilution of 1:100. Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

Applications for STIM2 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200

Western Blot

1:500 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.01% Thimerosal

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: STIM2

STIM2 is a member of the stromal interaction molecule (STIM) family and likely arose, with related family member STIM1, from a common ancestral gene. It encodes a type 1 transmembrane protein whose function is currently unknown, but is a likely adhesion molecule with a role in early hematopoiesis. Alternative translation initiation from an AUG and a non-AUG (UUG) start site results in the production of two different isoforms.

Alternate Names

FLJ39527, KIAA1482, stromal interaction molecule 2

Gene Symbol

STIM2

Additional STIM2 Products

Product Documents for STIM2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for STIM2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for STIM2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review STIM2 Antibody - BSA Free and earn rewards!

Have you used STIM2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...