STRA8 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-98492

Novus Biologicals
100% Guarantee

Key Product Details

Validated by

Knockout/Knockdown

Species Reactivity

Human, Mouse

Applications

Knockout Validated, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all STRA8 Primary Antibodies »

Product Specifications

Immunogen

The immunogen for this antibody is STRA8 - C-terminal region (NP_872295). Peptide sequence PEEKFQLYMQIINFFKGLSCANTQVKQEASFPVDEEMIMLQCTETFDDED. The peptide sequence for this immunogen was taken from within the described region.

Reactivity Notes

Mouse reactivity reported from a verified customer review as well as in-house test results.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

37 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for STRA8 Antibody - BSA Free

Western Blot: STRA8 Antibody [NBP1-98492]

Western Blot: STRA8 Antibody [NBP1-98492]

Western Blot: STRA8 Antibody [NBP1-98492] - Human Lung lysate. Antibody at 1.0 ug/mL.
Immunocytochemistry: STRA8 Antibody [NBP1-98492]

Immunocytochemistry: STRA8 Antibody [NBP1-98492]

Immunocytochemistry: STRA8 Antibody [NBP1-98492] - Adult mouse testis. ICC image submitted by a verified customer review.
Western Blot: STRA8 Antibody [NBP1-98492]

Western Blot: STRA8 Antibody [NBP1-98492]

Western Blot: STRA8 Antibody [NBP1-98492] - STRA8ko and wt protein to test stra8 protein level in mouse germ cells. WB image submitted by a verified customer review.

Applications for STRA8 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml
Application Notes
STRA8 Antibody validated for ICC from a verified customer review. STRA8 Antibody validated for KO from a verified customer review.

Reviewed Applications

Read 3 reviews rated 5 using NBP1-98492 in the following applications:

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: STRA8

This gene encodes a retinoic acid-responsive protein. A homologous protein in mouse has been shown to be involved in the regulation of meiotic initiation in both spermatogenesis and oogenesis, though feature differences between the mouse and human proteins suggest that these homologs are not entirely functionally equivalent. It is thought that this gene may play a role in spermatogenesis in humans.

Alternate Names

stimulated by retinoic acid gene 8 homolog (mouse), stimulated by retinoic acid gene 8 protein homolog

Entrez Gene IDs

346673 (Human)

Gene Symbol

STRA8

UniProt

Q7Z7C7 (Human)

Additional STRA8 Products

Product Documents for STRA8 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for STRA8 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for STRA8 Antibody - BSA Free (3)

5 out of 5
3 Customer Ratings
5 Stars
100%
4 Stars
0%
3 Stars
0%
2 Stars
0%
1 Stars
0%

Have you used STRA8 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Customer Images

Showing  1 - 3 of 3 reviews Showing All
Filter By:
Clear Filters X
  • STRA8 Antibody
    Name: Anonymous
    Application: Western Blot
    Sample Tested: Human testis
    Species: Human
    Verified Customer | Posted 08/05/2020
    Sorted huamn germ cell treat with actA and actA+SB 24 hours. Protein collected for stra8 WB.
    STRA8 Antibody - BSA Free NBP1-98492
  • STRA8 Antibody
    Name: Anonymous
    Application: Western Blot
    Sample Tested: germ cells
    Species: Mouse
    Verified Customer | Posted 11/11/2019
    STRA8 Antibody - BSA Free NBP1-98492
  • STRA8 Antibody
    Name: Anonymous
    Application: Immunocytochemistry
    Sample Tested: Adult testis
    Species: Mouse
    Verified Customer | Posted 10/09/2019
    STRA8 Antibody - BSA Free NBP1-98492

There are no reviews that match your criteria.

Showing  1 - 3 of 3 reviews Showing All

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies