STYK1 Antibody - BSA Free
Novus Biologicals | Catalog # NBP2-13398
![Western Blot: STYK1 Antibody [NBP2-13398]](https://resources.rndsystems.com/images/products/STYK1-Antibody-Western-Blot-NBP2-13398-img0003.jpg "Western Blot: STYK1 Antibody [NBP2-13398]")
Loading...
Key Product Details
Validated by
Orthogonal Validation
Species Reactivity
Human
Applications
Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
BSA Free
Loading...
Product Specifications
Immunogen
This antibody was developed against a recombinant protein corresponding to the amino acids: SGPQGIAPVPPPRDLSWEAGHGGNVALPLKETSVENFLGATTPALAKLQVPREQLSEVLEQICSGSCGPIFRANMNTGDPSKPKSVILKALKEPAGLHEVQDFLGRIQFHQYLGKHKNLVQLEGCCTEKLPLYM
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Description
Novus Biologicals Rabbit STYK1 Antibody - BSA Free (NBP2-13398) is a polyclonal antibody validated for use in IHC and WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
Scientific Data Images for STYK1 Antibody - BSA Free
Western Blot: STYK1 Antibody [NBP2-13398]
Western Blot: STYK1 Antibody [NBP2-13398] - Lane 1: Marker (kDa) 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4![Immunohistochemistry-Paraffin: STYK1 Antibody [NBP2-13398]](https://resources.rndsystems.com/images/products/STYK1-Antibody-Immunohistochemistry-Paraffin-NBP2-13398-img0004.jpg "Immunohistochemistry-Paraffin: STYK1 Antibody [NBP2-13398]")
Immunohistochemistry-Paraffin: STYK1 Antibody [NBP2-13398]
Immunohistochemistry-Paraffin: STYK1 Antibody [NBP2-13398] - Staining of human colon shows moderate cytoplasmic and membranous positivity in glandular cells.![STYK1 Antibody - BSA Free Immunohistochemistry: STYK1 Antibody - BSA Free [NBP2-13398]](https://resources.rndsystems.com/images/products/nbp2-13398_rabbit-polyclonal-styk1-antibody-30520257232110.jpg "Immunohistochemistry: STYK1 Antibody - BSA Free [NBP2-13398]")
Immunohistochemistry: STYK1 Antibody - BSA Free [NBP2-13398]
Staining of human small intestine shows strong membranous positivity in glandular cells.![STYK1 Antibody - BSA Free Immunohistochemistry: STYK1 Antibody - BSA Free [NBP2-13398]](https://resources.rndsystems.com/images/products/nbp2-13398_rabbit-polyclonal-styk1-antibody-30520251018349.jpg "Immunohistochemistry: STYK1 Antibody - BSA Free [NBP2-13398]")
Immunohistochemistry: STYK1 Antibody - BSA Free [NBP2-13398]
Staining of human skeletal muscle shows no membranous positivity in myocytes as expected.![STYK1 Antibody - BSA Free Immunohistochemistry: STYK1 Antibody - BSA Free [NBP2-13398]](https://resources.rndsystems.com/images/products/nbp2-13398_rabbit-polyclonal-styk1-antibody-305202510151112.jpg "Immunohistochemistry: STYK1 Antibody - BSA Free [NBP2-13398]")
Immunohistochemistry: STYK1 Antibody - BSA Free [NBP2-13398]
Staining of human stomach shows strong membranous positivity in glandular cells.![STYK1 Antibody - BSA Free Western Blot: STYK1 Antibody - BSA Free [NBP2-13398]](https://resources.rndsystems.com/images/products/nbp2-13398_rabbit-polyclonal-styk1-antibody-30520259585119.jpg "Western Blot: STYK1 Antibody - BSA Free [NBP2-13398]")
Western Blot: STYK1 Antibody - BSA Free [NBP2-13398]
Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Human cell line RT-4
![STYK1 Antibody - BSA Free Immunohistochemistry: STYK1 Antibody - BSA Free [NBP2-13398]](https://resources.rndsystems.com/images/products/nbp2-13398_rabbit-polyclonal-styk1-antibody-29520251613469.jpg "Immunohistochemistry: STYK1 Antibody - BSA Free [NBP2-13398]")
![STYK1 Antibody - BSA Free Immunohistochemistry: STYK1 Antibody - BSA Free [NBP2-13398]](https://resources.rndsystems.com/images/products/nbp2-13398_rabbit-polyclonal-styk1-antibody-295202516445721.jpg "Immunohistochemistry: STYK1 Antibody - BSA Free [NBP2-13398]")
Immunohistochemistry: STYK1 Antibody - BSA Free [NBP2-13398]
Staining of human prostate shows moderate membranous positivity in glandular cells.Applications for STYK1 Antibody - BSA Free
Application
Recommended Usage
Immunohistochemistry
1:50 - 1:200
Immunohistochemistry-Paraffin
1:50 - 1:200
Western Blot
0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.2) and 40% Glycerol
Format
BSA Free
Preservative
0.02% Sodium Azide
Concentration
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: STYK1
Long Name
Serine/Threonine/Tyrosine Kinase 1
Alternate Names
NOK
Gene Symbol
STYK1
Additional STYK1 Products
Product Documents for STYK1 Antibody - BSA Free
Product Specific Notices for STYK1 Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Related Research Areas
Customer Reviews for STYK1 Antibody - BSA Free
There are currently no reviews for this product. Be the first to review STYK1 Antibody - BSA Free and earn rewards!
Have you used STYK1 Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Antigen Retrieval Protocol (PIER)
- Antigen Retrieval for Frozen Sections Protocol
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- Chromogenic IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Chromogenic Immunohistochemistry Staining of Frozen Tissue
- Detection & Visualization of Antibody Binding
- Fluorescent IHC Staining of Frozen Tissue Protocol
- Graphic Protocol for Heat-induced Epitope Retrieval
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Graphic Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- IHC Sample Preparation (Frozen sections vs Paraffin)
- Immunofluorescent IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunohistochemistry Frozen Troubleshooting
- Immunohistochemistry Paraffin Troubleshooting
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for Heat-Induced Epitope Retrieval (HIER)
- Protocol for Making a 4% Formaldehyde Solution in PBS
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Preparation & Fixation of Cells on Coverslips
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections - Graphic
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections - Graphic
- Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- R&D Systems Quality Control Western Blot Protocol
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: Immunohistochemistry
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...