Surfactant Protein A Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-46679

Novus Biologicals
100% Guarantee

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Validated:

Human

Cited:

IHC-P

Applications

Validated:

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Cited:

Immunohistochemistry-Paraffin

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all SFTPA1 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: PGLPAHLDEELQATLHDFRHQILQTRGALSLQGSIMTVGEKVFSSNGQSITFDAIQEACARA

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Surfactant Protein A Antibody - BSA Free

Immunohistochemistry-Paraffin: Surfactant Protein A Antibody [NBP2-46679]

Immunohistochemistry-Paraffin: Surfactant Protein A Antibody [NBP2-46679]

Immunohistochemistry-Paraffin: Surfactant Protein A Antibody [NBP2-46679] - Analysis in human lung and liver tissues using NBP2-46679 antibody. Corresponding SFTPA1 RNA-seq data are presented for the same tissues.
Western Blot: Surfactant Protein A Antibody [NBP2-46679]

Western Blot: Surfactant Protein A Antibody [NBP2-46679]

Western Blot: Surfactant Protein A Antibody [NBP2-46679] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10, Lane 2: Human cell line RT-4, Lane 3: Human cell line U-251 MG, Lane 4: Human plasma
Immunohistochemistry-Paraffin: Surfactant Protein A Antibody [NBP2-46679]

Immunohistochemistry-Paraffin: Surfactant Protein A Antibody [NBP2-46679]

Immunohistochemistry-Paraffin: Surfactant Protein A Antibody [NBP2-46679] - Staining of human Lung shows strong cytoplasmic positivity in pneumocytes.
Immunohistochemistry-Paraffin: Surfactant Protein A Antibody [NBP2-46679]

Immunohistochemistry-Paraffin: Surfactant Protein A Antibody [NBP2-46679]

Immunohistochemistry-Paraffin: Surfactant Protein A Antibody [NBP2-46679] - Staining of human rectum shows no positvity in glanular cells as expected.
Immunohistochemistry-Paraffin: Surfactant Protein A Antibody [NBP2-46679]

Immunohistochemistry-Paraffin: Surfactant Protein A Antibody [NBP2-46679]

Immunohistochemistry-Paraffin: Surfactant Protein A Antibody [NBP2-46679] - Staining of human liver shows no positivity in hepatocytes as expected.
Immunohistochemistry-Paraffin: Surfactant Protein A Antibody [NBP2-46679]

Immunohistochemistry-Paraffin: Surfactant Protein A Antibody [NBP2-46679]

Immunohistochemistry-Paraffin: Surfactant Protein A Antibody [NBP2-46679] - Staining of human kidney shows no postivity in cells in tubules as expected.
Immunohistochemistry-Paraffin: Surfactant Protein A Antibody [NBP2-46679]

Immunohistochemistry-Paraffin: Surfactant Protein A Antibody [NBP2-46679]

Immunohistochemistry-Paraffin: Surfactant Protein A Antibody [NBP2-46679] - Analysis in human lung and liver tissues using NBP2-46679 antibody. Corresponding SFTPA1 RNA-seq data are presented for the same tissues.

Applications for Surfactant Protein A Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Paraffin

1:200 - 1:500

Western Blot

0.04-0.4 µg/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: SFTPA1

Surfactant protein A is a protein with two isoforms, with lengths of 248 and 263 amino acids and weights of approximately 26 and 28 kDa respectively. Surfactant protein A binds to surfactant phospholipids in the presence of calcium ions and helps lower the surface tension in the alveoli of the lungs. Current research is being done on several diseases and disorders linked to this protein including pulmonary fibrosis, allergic bronchopulmonary aspergillosis, pulmonary alveolar proteinosis, non-small cell lung carcinoma, sclerosing hemangioma, otitis media, chronic obstructive pulmonary disease, bronchitis obliterans, bronchopulmonary dysplasia, rhinitis, aspergillosis, pulmonary edema, insulin resistance, and pneumoconiosis. Surfactant protein A has also been shown to have interactions with DMBT1, MYO18A, C1QA, SFTPD, and TLR2 in pathways such as the immune response, bacterial infections in CF airways, cell-cell communication, phagosome, and pertussis pathways.

Long Name

Surfactant Protein A1

Alternate Names

COLEC4, PSP-A, SP-A, SP-A1

Entrez Gene IDs

729238 (Human)

Gene Symbol

SFTPA1

UniProt

Q8IWL1 (Human)

Additional SFTPA1 Products

Product Documents for Surfactant Protein A Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Surfactant Protein A Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for Surfactant Protein A Antibody - BSA Free

Customer Reviews for Surfactant Protein A Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Surfactant Protein A Antibody - BSA Free and earn rewards!

Have you used Surfactant Protein A Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies