Synaptogyrin 2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-13403

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Validated:

Human

Predicted:

Mouse (92%), Rat (91%). Backed by our 100% Guarantee.

Applications

Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all Synaptogyrin 2 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the amino acids: QRYKAGVDDFIQNYVDPTPDPNTAYASYPGASVDNYQQPPFTQNAETTEGYQP

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Synaptogyrin 2 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: Synaptogyrin 2 Antibody [NBP2-13403]

Immunocytochemistry/ Immunofluorescence: Synaptogyrin 2 Antibody [NBP2-13403]

Immunocytochemistry/Immunofluorescence: Synaptogyrin 2 Antibody [NBP2-13403] - Immunofluorescent staining of human cell line A-431 shows localization to the Golgi apparatus.
Synaptogyrin 2 Antibody - BSA Free Immunohistochemistry: Synaptogyrin 2 Antibody - BSA Free [NBP2-13403]

Immunohistochemistry: Synaptogyrin 2 Antibody - BSA Free [NBP2-13403]

Staining of human rectum strong cytoplasmic positivity in glandular cells.
Synaptogyrin 2 Antibody - BSA Free Immunohistochemistry: Synaptogyrin 2 Antibody - BSA Free [NBP2-13403]

Immunohistochemistry: Synaptogyrin 2 Antibody - BSA Free [NBP2-13403]

Staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells.
Synaptogyrin 2 Antibody - BSA Free Immunohistochemistry: Synaptogyrin 2 Antibody - BSA Free [NBP2-13403]

Immunohistochemistry: Synaptogyrin 2 Antibody - BSA Free [NBP2-13403]

Staining of human tonsil shows strong cytoplasmic-membranous positivity in non-germinal center cells.
Synaptogyrin 2 Antibody - BSA Free Immunohistochemistry: Synaptogyrin 2 Antibody - BSA Free [NBP2-13403]

Immunohistochemistry: Synaptogyrin 2 Antibody - BSA Free [NBP2-13403]

Staining of human prostate shows moderate cytoplasmic positivity in glandular cells.

Applications for Synaptogyrin 2 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Synaptogyrin 2

Synaptogyrin 2 is an integral membrane protein containing four transmembrane regions and a C-terminal cytoplasmic tail that is tyrosine phosphorylated. The exact function of this protein is unclear, but studies of a similar rat protein suggest that it may play a role in regulating membrane traffic in non-neuronal cells.

Alternate Names

Cellugyrin, MGC102914, synaptogyrin 2, synaptogyrin-2

Gene Symbol

SYNGR2

Additional Synaptogyrin 2 Products

Product Documents for Synaptogyrin 2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Synaptogyrin 2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Synaptogyrin 2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Synaptogyrin 2 Antibody - BSA Free and earn rewards!

Have you used Synaptogyrin 2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies